Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R4XH18

Protein Details
Accession R4XH18    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28LFIGRSRKIPLLKRRVRPRRPLGLAFTHydrophilic
NLS Segment(s)
PositionSequence
7-22SRKIPLLKRRVRPRRP
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MLFIGRSRKIPLLKRRVRPRRPLGLAFTRVRIDPVAMVFLQCSAEYFLERYFKFLRCSARAGNRNKVNCMDSSMFKVFCKAKMSHQSTIDSIVNQYLTDAEKQEYMEWEAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.86
4 0.88
5 0.9
6 0.88
7 0.88
8 0.86
9 0.8
10 0.77
11 0.74
12 0.71
13 0.63
14 0.56
15 0.47
16 0.4
17 0.36
18 0.28
19 0.2
20 0.14
21 0.13
22 0.12
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.07
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.1
35 0.14
36 0.14
37 0.17
38 0.18
39 0.2
40 0.22
41 0.25
42 0.28
43 0.26
44 0.29
45 0.3
46 0.37
47 0.42
48 0.45
49 0.51
50 0.52
51 0.52
52 0.51
53 0.49
54 0.41
55 0.34
56 0.34
57 0.27
58 0.22
59 0.26
60 0.26
61 0.24
62 0.22
63 0.27
64 0.23
65 0.25
66 0.29
67 0.25
68 0.31
69 0.41
70 0.47
71 0.48
72 0.49
73 0.49
74 0.44
75 0.48
76 0.4
77 0.3
78 0.25
79 0.21
80 0.18
81 0.15
82 0.14
83 0.1
84 0.11
85 0.12
86 0.14
87 0.13
88 0.15
89 0.16
90 0.18
91 0.19