Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S4N5

Protein Details
Accession F4S4N5   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
111-131AHPPRVTSYRKPKPEHPWAGKBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 12.5, mito 5.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_67846  -  
Amino Acid Sequences MERRSVLSGQNSQSGFHIPNIGKGFTTETDQLKPHMSFDMIQQQGNWQDVIPYNIALRQAFATRRHLSFTDFASDKLSHLKHLALADKKSSRDSHHMSNSNGVASSSTTKAHPPRVTSYRKPKPEHPWAGKVKNMRNLPRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.22
4 0.27
5 0.21
6 0.27
7 0.3
8 0.29
9 0.25
10 0.25
11 0.27
12 0.21
13 0.25
14 0.22
15 0.22
16 0.24
17 0.25
18 0.26
19 0.27
20 0.26
21 0.23
22 0.2
23 0.19
24 0.16
25 0.19
26 0.27
27 0.23
28 0.23
29 0.22
30 0.23
31 0.24
32 0.24
33 0.21
34 0.11
35 0.12
36 0.12
37 0.14
38 0.12
39 0.1
40 0.09
41 0.1
42 0.12
43 0.1
44 0.1
45 0.09
46 0.11
47 0.14
48 0.17
49 0.22
50 0.24
51 0.24
52 0.26
53 0.26
54 0.25
55 0.24
56 0.22
57 0.2
58 0.18
59 0.17
60 0.18
61 0.18
62 0.16
63 0.19
64 0.18
65 0.15
66 0.15
67 0.15
68 0.14
69 0.16
70 0.21
71 0.2
72 0.21
73 0.25
74 0.27
75 0.28
76 0.3
77 0.3
78 0.29
79 0.33
80 0.36
81 0.39
82 0.45
83 0.49
84 0.46
85 0.48
86 0.45
87 0.37
88 0.33
89 0.25
90 0.17
91 0.13
92 0.15
93 0.12
94 0.12
95 0.13
96 0.19
97 0.23
98 0.32
99 0.34
100 0.35
101 0.42
102 0.5
103 0.58
104 0.62
105 0.69
106 0.7
107 0.76
108 0.77
109 0.78
110 0.79
111 0.82
112 0.83
113 0.79
114 0.79
115 0.8
116 0.8
117 0.76
118 0.75
119 0.72
120 0.7
121 0.71