Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R4XAW3

Protein Details
Accession R4XAW3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-31SSIKKAPRLNLQKLKVRPRKEKNAGPCAAHydrophilic
NLS Segment(s)
PositionSequence
15-23KLKVRPRKE
Subcellular Location(s) nucl 14, mito_nucl 13.5, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSSIKKAPRLNLQKLKVRPRKEKNAGPCAAEMAAMLGCWASHGDNPDAAQCASFANNLKTCMNDSTRFVKKDNTINYHLARLGKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.82
4 0.8
5 0.79
6 0.79
7 0.79
8 0.83
9 0.83
10 0.83
11 0.81
12 0.83
13 0.75
14 0.66
15 0.57
16 0.47
17 0.38
18 0.3
19 0.2
20 0.11
21 0.08
22 0.06
23 0.05
24 0.04
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.07
31 0.08
32 0.08
33 0.09
34 0.09
35 0.1
36 0.1
37 0.09
38 0.07
39 0.07
40 0.07
41 0.09
42 0.1
43 0.13
44 0.15
45 0.18
46 0.18
47 0.18
48 0.2
49 0.22
50 0.24
51 0.23
52 0.25
53 0.31
54 0.37
55 0.39
56 0.38
57 0.4
58 0.42
59 0.48
60 0.53
61 0.52
62 0.5
63 0.54
64 0.55
65 0.52
66 0.49
67 0.43