Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G6Q8

Protein Details
Accession R1G6Q8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
177-201LGNMRKERKVYWRREKEIDKRKEEWBasic
NLS Segment(s)
PositionSequence
165-199AGGRLSKREEGALGNMRKERKVYWRREKEIDKRKE
Subcellular Location(s) mito 13, mito_nucl 12.833, nucl 11.5, cyto_mito 8.333
Family & Domain DBs
KEGG npa:UCRNP2_6088  -  
Amino Acid Sequences MPPKTPARKLLRMPKFSTPKTLRLDSFLSAVHNANKGNSEAWAAAKWDDVADEYLAAHEAFHRRGSRSHSNALSELASPAARSLRNRFESYRSKASANRKPGAEAAAKTPDGWTVPDPLDCGKIMNLRYAGCLSKVAAANEGRFLDKESADEVLRRFEERAREAAGGRLSKREEGALGNMRKERKVYWRREKEIDKRKEEWMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.71
4 0.72
5 0.66
6 0.65
7 0.64
8 0.65
9 0.56
10 0.51
11 0.51
12 0.42
13 0.38
14 0.31
15 0.26
16 0.22
17 0.23
18 0.21
19 0.21
20 0.2
21 0.19
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.14
29 0.14
30 0.13
31 0.12
32 0.13
33 0.12
34 0.1
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.07
44 0.06
45 0.08
46 0.1
47 0.12
48 0.16
49 0.18
50 0.19
51 0.23
52 0.31
53 0.37
54 0.39
55 0.44
56 0.43
57 0.42
58 0.41
59 0.39
60 0.32
61 0.23
62 0.18
63 0.13
64 0.1
65 0.08
66 0.08
67 0.09
68 0.1
69 0.12
70 0.17
71 0.24
72 0.28
73 0.31
74 0.32
75 0.37
76 0.44
77 0.47
78 0.49
79 0.43
80 0.41
81 0.44
82 0.51
83 0.52
84 0.51
85 0.48
86 0.41
87 0.41
88 0.39
89 0.37
90 0.3
91 0.23
92 0.19
93 0.19
94 0.19
95 0.17
96 0.17
97 0.14
98 0.12
99 0.13
100 0.1
101 0.1
102 0.11
103 0.11
104 0.12
105 0.12
106 0.12
107 0.11
108 0.11
109 0.1
110 0.13
111 0.13
112 0.16
113 0.16
114 0.15
115 0.16
116 0.17
117 0.16
118 0.13
119 0.13
120 0.11
121 0.14
122 0.16
123 0.15
124 0.17
125 0.18
126 0.18
127 0.2
128 0.2
129 0.17
130 0.15
131 0.17
132 0.15
133 0.14
134 0.14
135 0.13
136 0.14
137 0.14
138 0.16
139 0.15
140 0.17
141 0.18
142 0.18
143 0.18
144 0.2
145 0.26
146 0.27
147 0.29
148 0.28
149 0.28
150 0.28
151 0.31
152 0.33
153 0.3
154 0.28
155 0.3
156 0.29
157 0.29
158 0.3
159 0.26
160 0.23
161 0.2
162 0.26
163 0.3
164 0.31
165 0.34
166 0.38
167 0.39
168 0.4
169 0.4
170 0.38
171 0.4
172 0.47
173 0.54
174 0.61
175 0.69
176 0.74
177 0.81
178 0.87
179 0.86
180 0.87
181 0.86
182 0.82
183 0.75