Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RNL8

Protein Details
Accession F4RNL8    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-52LKSTFIKRRNRGRNGEKPGGNHydrophilic
NLS Segment(s)
PositionSequence
36-60FIKRRNRGRNGEKPGGNKKPAKPKV
Subcellular Location(s) mito 22, nucl 2, extr 1, cyto_nucl 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG mlr:MELLADRAFT_48582  -  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences TPLWRRNGEGKPLCNACGLFLNLHGIPRPAALKSTFIKRRNRGRNGEKPGGNKKPAKPKVPLNEPIHSKPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.3
4 0.26
5 0.24
6 0.17
7 0.15
8 0.18
9 0.16
10 0.16
11 0.15
12 0.12
13 0.11
14 0.12
15 0.12
16 0.09
17 0.1
18 0.11
19 0.14
20 0.15
21 0.24
22 0.31
23 0.37
24 0.45
25 0.51
26 0.61
27 0.67
28 0.74
29 0.74
30 0.76
31 0.8
32 0.8
33 0.8
34 0.74
35 0.71
36 0.73
37 0.71
38 0.68
39 0.65
40 0.63
41 0.66
42 0.71
43 0.69
44 0.66
45 0.68
46 0.71
47 0.73
48 0.76
49 0.71
50 0.71
51 0.72