Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EA00

Protein Details
Accession R1EA00    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-139AEPPRGRKQVRERRSPHGRNBasic
NLS Segment(s)
PositionSequence
122-135PPRGRKQVRERRSP
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
KEGG npa:UCRNP2_9083  -  
Amino Acid Sequences MADKPYNNTLDRENLDLRRLKDELEQQGYQETQEISQLREQVKELTKGNKELKRDSNKLHKTNEEHLKQNMEILEEKAKLHQAFEQQNKLITKLYQDLNHYYNSDRPAAHGPPPNPGGLAEPPRGRKQVRERRSPHGRNASYEYRYGHIPLRDRDLMPARDFHDYPPQTPIGSSWEPAIIRLLLIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.44
4 0.43
5 0.41
6 0.39
7 0.35
8 0.35
9 0.41
10 0.43
11 0.44
12 0.42
13 0.37
14 0.4
15 0.39
16 0.32
17 0.27
18 0.19
19 0.12
20 0.17
21 0.18
22 0.16
23 0.19
24 0.24
25 0.22
26 0.23
27 0.24
28 0.26
29 0.29
30 0.32
31 0.32
32 0.35
33 0.37
34 0.43
35 0.51
36 0.48
37 0.48
38 0.51
39 0.57
40 0.58
41 0.6
42 0.6
43 0.62
44 0.67
45 0.69
46 0.66
47 0.63
48 0.59
49 0.63
50 0.66
51 0.59
52 0.53
53 0.49
54 0.48
55 0.41
56 0.38
57 0.29
58 0.22
59 0.19
60 0.17
61 0.18
62 0.16
63 0.16
64 0.15
65 0.18
66 0.16
67 0.16
68 0.17
69 0.2
70 0.26
71 0.3
72 0.33
73 0.3
74 0.34
75 0.33
76 0.32
77 0.26
78 0.19
79 0.17
80 0.16
81 0.18
82 0.17
83 0.19
84 0.21
85 0.21
86 0.22
87 0.21
88 0.18
89 0.19
90 0.19
91 0.19
92 0.15
93 0.16
94 0.2
95 0.21
96 0.25
97 0.28
98 0.26
99 0.29
100 0.3
101 0.28
102 0.24
103 0.22
104 0.19
105 0.18
106 0.22
107 0.21
108 0.24
109 0.28
110 0.31
111 0.36
112 0.34
113 0.38
114 0.45
115 0.52
116 0.57
117 0.64
118 0.65
119 0.71
120 0.81
121 0.78
122 0.76
123 0.76
124 0.7
125 0.64
126 0.66
127 0.63
128 0.54
129 0.51
130 0.44
131 0.34
132 0.33
133 0.31
134 0.29
135 0.27
136 0.31
137 0.31
138 0.36
139 0.38
140 0.38
141 0.42
142 0.45
143 0.44
144 0.4
145 0.41
146 0.36
147 0.38
148 0.38
149 0.34
150 0.37
151 0.35
152 0.34
153 0.36
154 0.34
155 0.29
156 0.29
157 0.27
158 0.24
159 0.24
160 0.23
161 0.2
162 0.23
163 0.22
164 0.23
165 0.24
166 0.17