Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1ECB8

Protein Details
Accession R1ECB8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-28GMGNGTKPIHNKKPKKKEVDEDDDDBasic
NLS Segment(s)
PositionSequence
14-20NKKPKKK
61-81KAKGKGPLNTGSQGIKKSGKK
Subcellular Location(s) mito 12, nucl 10, cyto 4.5, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG npa:UCRNP2_8140  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MPSGMGNGTKPIHNKKPKKKEVDEDDDDKAFKAKQMAVSVANHATPRRTADKKALQELQGKAKGKGPLNTGSQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.79
4 0.85
5 0.88
6 0.87
7 0.87
8 0.86
9 0.84
10 0.79
11 0.72
12 0.66
13 0.56
14 0.49
15 0.38
16 0.3
17 0.21
18 0.16
19 0.14
20 0.13
21 0.15
22 0.17
23 0.18
24 0.19
25 0.19
26 0.2
27 0.18
28 0.17
29 0.14
30 0.12
31 0.12
32 0.11
33 0.14
34 0.19
35 0.22
36 0.24
37 0.32
38 0.41
39 0.44
40 0.5
41 0.5
42 0.47
43 0.5
44 0.51
45 0.5
46 0.48
47 0.45
48 0.4
49 0.42
50 0.44
51 0.42
52 0.43
53 0.39
54 0.38
55 0.41
56 0.42
57 0.39
58 0.38
59 0.37
60 0.34
61 0.35