Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GIP6

Protein Details
Accession R1GIP6    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQRRRNPARNQKPEPTPAKEHydrophilic
109-145LYYSKAGKKKLPNKGKNKEEKEKYKEKDKDKEKEKDEBasic
NLS Segment(s)
PositionSequence
5-36RNPARNQKPEPTPAKESPAPTKDNAKGKRKDT
113-148KAGKKKLPNKGKNKEEKEKYKEKDKDKEKEKDEKDK
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037651  Swc3  
Gene Ontology GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
KEGG npa:UCRNP2_5051  -  
Amino Acid Sequences MQRRRNPARNQKPEPTPAKESPAPTKDNAKGKRKDTPANEKPAEAPSAPPPPPPLPTKLATGQPIPTVPEPQPADLPESDWQSVVESGVLKAALERSRQKWMTPGIFELYYSKAGKKKLPNKGKNKEEKEKYKEKDKDKEKEKDEKDKDGGEGAVGSKESESLKAKQMKREGNCKLYIDPHHGVEACA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.74
4 0.67
5 0.66
6 0.62
7 0.59
8 0.59
9 0.57
10 0.53
11 0.48
12 0.52
13 0.52
14 0.57
15 0.61
16 0.62
17 0.64
18 0.65
19 0.71
20 0.7
21 0.72
22 0.71
23 0.73
24 0.71
25 0.73
26 0.69
27 0.61
28 0.56
29 0.5
30 0.44
31 0.33
32 0.27
33 0.23
34 0.29
35 0.28
36 0.28
37 0.3
38 0.29
39 0.32
40 0.33
41 0.32
42 0.29
43 0.31
44 0.33
45 0.32
46 0.33
47 0.32
48 0.31
49 0.27
50 0.24
51 0.23
52 0.22
53 0.19
54 0.18
55 0.16
56 0.22
57 0.22
58 0.21
59 0.22
60 0.2
61 0.22
62 0.19
63 0.21
64 0.16
65 0.17
66 0.17
67 0.15
68 0.15
69 0.13
70 0.13
71 0.1
72 0.08
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.08
80 0.09
81 0.12
82 0.16
83 0.17
84 0.25
85 0.26
86 0.26
87 0.27
88 0.31
89 0.31
90 0.28
91 0.27
92 0.22
93 0.22
94 0.21
95 0.19
96 0.15
97 0.15
98 0.15
99 0.17
100 0.18
101 0.21
102 0.27
103 0.35
104 0.42
105 0.49
106 0.6
107 0.67
108 0.74
109 0.82
110 0.86
111 0.87
112 0.86
113 0.86
114 0.85
115 0.85
116 0.82
117 0.82
118 0.77
119 0.77
120 0.76
121 0.75
122 0.75
123 0.74
124 0.76
125 0.76
126 0.8
127 0.77
128 0.79
129 0.77
130 0.78
131 0.74
132 0.72
133 0.66
134 0.58
135 0.52
136 0.44
137 0.37
138 0.26
139 0.22
140 0.15
141 0.13
142 0.11
143 0.1
144 0.08
145 0.1
146 0.1
147 0.14
148 0.17
149 0.19
150 0.28
151 0.36
152 0.41
153 0.47
154 0.55
155 0.6
156 0.63
157 0.7
158 0.7
159 0.68
160 0.69
161 0.64
162 0.58
163 0.57
164 0.55
165 0.52
166 0.47
167 0.42
168 0.42