Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GBI5

Protein Details
Accession R1GBI5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
191-232EANGKKGRGRPKKADSGEKPATKAKPKKQPKKAATETGEPRRBasic
NLS Segment(s)
PositionSequence
94-174EKKDEESKEDKKEETNGEKKDEKEEKKEEKKEEEKKEESAKEADKAEKSDEKENGEAQTGDKRKAKKTNGEAKKGDEEKSE
176-176K
181-238PPAKQQKTDAEANGKKGRGRPKKADSGEKPATKAKPKKQPKKAATETGEPRRSARNRS
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
IPR021331  Hva1_TUDOR  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG npa:UCRNP2_4345  -  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSEQEIQKGDEVSWKWGGGAPSGTVAEVAKEGEVAIESHRGNTIKKNAEPDNPAVHIERPGNDVVKKASELQIEDKANGAEDKAEDKKEEDKAEKKDEESKEDKKEETNGEKKDEKEEKKEEKKEEEKKEESAKEADKAEKSDEKENGEAQTGDKRKAKKTNGEAKKGDEEKSEDKEDGEPPAKQQKTDAEANGKKGRGRPKKADSGEKPATKAKPKKQPKKAATETGEPRRSARNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.25
4 0.26
5 0.21
6 0.21
7 0.16
8 0.17
9 0.17
10 0.16
11 0.13
12 0.12
13 0.11
14 0.09
15 0.09
16 0.07
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.07
23 0.12
24 0.12
25 0.13
26 0.17
27 0.18
28 0.19
29 0.26
30 0.33
31 0.35
32 0.38
33 0.44
34 0.45
35 0.5
36 0.53
37 0.5
38 0.46
39 0.4
40 0.39
41 0.34
42 0.3
43 0.28
44 0.26
45 0.23
46 0.2
47 0.21
48 0.22
49 0.21
50 0.22
51 0.2
52 0.2
53 0.2
54 0.19
55 0.21
56 0.2
57 0.21
58 0.23
59 0.28
60 0.27
61 0.26
62 0.25
63 0.21
64 0.2
65 0.18
66 0.14
67 0.08
68 0.07
69 0.12
70 0.13
71 0.14
72 0.14
73 0.16
74 0.2
75 0.24
76 0.27
77 0.29
78 0.33
79 0.37
80 0.44
81 0.43
82 0.41
83 0.45
84 0.42
85 0.43
86 0.43
87 0.43
88 0.43
89 0.44
90 0.43
91 0.36
92 0.38
93 0.37
94 0.39
95 0.4
96 0.36
97 0.39
98 0.41
99 0.4
100 0.44
101 0.47
102 0.42
103 0.43
104 0.48
105 0.53
106 0.59
107 0.65
108 0.61
109 0.6
110 0.66
111 0.68
112 0.69
113 0.67
114 0.6
115 0.57
116 0.6
117 0.53
118 0.46
119 0.41
120 0.34
121 0.29
122 0.29
123 0.28
124 0.22
125 0.23
126 0.24
127 0.24
128 0.26
129 0.28
130 0.29
131 0.29
132 0.29
133 0.29
134 0.26
135 0.23
136 0.21
137 0.16
138 0.22
139 0.21
140 0.24
141 0.27
142 0.3
143 0.36
144 0.45
145 0.5
146 0.51
147 0.6
148 0.66
149 0.7
150 0.75
151 0.7
152 0.65
153 0.68
154 0.61
155 0.52
156 0.44
157 0.41
158 0.38
159 0.41
160 0.39
161 0.3
162 0.29
163 0.3
164 0.28
165 0.29
166 0.27
167 0.22
168 0.24
169 0.33
170 0.33
171 0.31
172 0.33
173 0.33
174 0.35
175 0.4
176 0.4
177 0.4
178 0.43
179 0.5
180 0.52
181 0.48
182 0.46
183 0.47
184 0.54
185 0.54
186 0.6
187 0.63
188 0.66
189 0.74
190 0.78
191 0.83
192 0.78
193 0.77
194 0.77
195 0.71
196 0.66
197 0.62
198 0.63
199 0.62
200 0.66
201 0.66
202 0.68
203 0.76
204 0.83
205 0.87
206 0.91
207 0.89
208 0.9
209 0.89
210 0.88
211 0.83
212 0.82
213 0.8
214 0.8
215 0.77
216 0.67
217 0.61
218 0.61