Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RBP3

Protein Details
Accession F4RBP3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-55GKRVLRTVKKGSKHRFIRRGVKEBasic
NLS Segment(s)
PositionSequence
30-63KKLGKRVLRTVKKGSKHRFIRRGVKEVVKALRKG
Subcellular Location(s) cyto 10.5, cysk 10, cyto_nucl 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:0031429  C:box H/ACA snoRNP complex  
GO:0034513  F:box H/ACA snoRNA binding  
GO:0031118  P:rRNA pseudouridine synthesis  
GO:0031120  P:snRNA pseudouridine synthesis  
KEGG mlr:MELLADRAFT_34068  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MKDGDLPETTTLDSSLLDALSPIAHPLADKKLGKRVLRTVKKGSKHRFIRRGVKEVVKALRKGDKGLVVMAGDISPMDVLTHIPLLAEENGSGYVFVTSKESLGLASSTKRPTSCVMISNSSAAKIKEEVEEYATSYQEVLQEVLQLVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.06
10 0.06
11 0.06
12 0.06
13 0.09
14 0.14
15 0.21
16 0.24
17 0.26
18 0.34
19 0.42
20 0.44
21 0.46
22 0.51
23 0.55
24 0.61
25 0.65
26 0.67
27 0.67
28 0.73
29 0.78
30 0.76
31 0.76
32 0.77
33 0.81
34 0.79
35 0.8
36 0.82
37 0.78
38 0.76
39 0.71
40 0.65
41 0.58
42 0.54
43 0.53
44 0.47
45 0.41
46 0.38
47 0.39
48 0.35
49 0.33
50 0.3
51 0.26
52 0.22
53 0.21
54 0.19
55 0.12
56 0.12
57 0.1
58 0.08
59 0.05
60 0.04
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.07
86 0.08
87 0.08
88 0.08
89 0.07
90 0.08
91 0.08
92 0.07
93 0.1
94 0.14
95 0.16
96 0.19
97 0.19
98 0.2
99 0.22
100 0.28
101 0.28
102 0.29
103 0.3
104 0.32
105 0.33
106 0.34
107 0.31
108 0.27
109 0.26
110 0.21
111 0.19
112 0.17
113 0.18
114 0.18
115 0.2
116 0.2
117 0.21
118 0.21
119 0.21
120 0.22
121 0.2
122 0.17
123 0.15
124 0.15
125 0.13
126 0.14
127 0.12
128 0.11
129 0.12