Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R3A9

Protein Details
Accession F4R3A9    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
132-153EERSNNKKEKRGKPDGRPLLDRBasic
NLS Segment(s)
PositionSequence
84-100KKNGGKKKGGVKGKEKK
136-180NNKKEKRGKPDGRPLLDRNGGEEKGRGGGCERWRREEERRKDGEG
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_101005  -  
Amino Acid Sequences MEQVESRRRRMESRAPGGTQSTSMNPTQTEQGERIEGGVVEGGGKESQVVDEENGKGEEVREGSGDQSESEELMKEDIQREIQKKNGGKKKGGVKGKEKKETSSSGSESDEGWLRKVKDYGMLVEKDNRPTEERSNNKKEKRGKPDGRPLLDRNGGEEKGRGGGCERWRREEERRKDGEGEERRKVEVIEEEEVRKGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.61
3 0.6
4 0.59
5 0.51
6 0.42
7 0.34
8 0.28
9 0.24
10 0.23
11 0.22
12 0.2
13 0.21
14 0.23
15 0.23
16 0.24
17 0.22
18 0.23
19 0.23
20 0.22
21 0.2
22 0.17
23 0.14
24 0.11
25 0.1
26 0.07
27 0.06
28 0.06
29 0.07
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.07
38 0.11
39 0.11
40 0.13
41 0.13
42 0.13
43 0.12
44 0.11
45 0.12
46 0.1
47 0.1
48 0.09
49 0.09
50 0.1
51 0.11
52 0.11
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.13
66 0.17
67 0.2
68 0.21
69 0.24
70 0.29
71 0.33
72 0.41
73 0.46
74 0.45
75 0.45
76 0.49
77 0.54
78 0.56
79 0.58
80 0.54
81 0.56
82 0.62
83 0.67
84 0.7
85 0.62
86 0.56
87 0.54
88 0.51
89 0.45
90 0.4
91 0.33
92 0.27
93 0.27
94 0.25
95 0.21
96 0.19
97 0.18
98 0.14
99 0.14
100 0.16
101 0.16
102 0.17
103 0.18
104 0.17
105 0.18
106 0.19
107 0.21
108 0.22
109 0.22
110 0.22
111 0.28
112 0.29
113 0.29
114 0.29
115 0.28
116 0.26
117 0.28
118 0.34
119 0.37
120 0.44
121 0.5
122 0.58
123 0.66
124 0.69
125 0.73
126 0.76
127 0.76
128 0.77
129 0.79
130 0.78
131 0.79
132 0.85
133 0.86
134 0.81
135 0.77
136 0.7
137 0.66
138 0.62
139 0.52
140 0.46
141 0.42
142 0.38
143 0.32
144 0.3
145 0.24
146 0.23
147 0.23
148 0.19
149 0.16
150 0.22
151 0.31
152 0.4
153 0.43
154 0.45
155 0.5
156 0.56
157 0.64
158 0.68
159 0.68
160 0.69
161 0.71
162 0.67
163 0.67
164 0.64
165 0.63
166 0.63
167 0.61
168 0.58
169 0.55
170 0.52
171 0.49
172 0.46
173 0.39
174 0.36
175 0.33
176 0.31
177 0.32
178 0.32
179 0.34