Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1G0D7

Protein Details
Accession R1G0D7    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-57AKMFRFCRSKCHKNFKMKRNPRKLAWTKSYRHydrophilic
173-199EEEKTRIRAKVPKAKRKQKLVVGKGVEBasic
NLS Segment(s)
PositionSequence
178-191RIRAKVPKAKRKQK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
KEGG npa:UCRNP2_8410  -  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MRISKELRNAIGRNPDGMGYDNGDRHAKMFRFCRSKCHKNFKMKRNPRKLAWTKSYRAAHGKEMTVDSTLAFAARRNVPVRYNRDLVAKTLQAMKRVEEVKQRRERLFYKERMKGNKERQLAADRKLVEEFQHLLPPELRDEVPEHVRQKLEKMDVEQEDLDEMDEEELDEEEEEKTRIRAKVPKAKRKQKLVVGKGVEDMDVDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.29
4 0.3
5 0.25
6 0.19
7 0.21
8 0.21
9 0.22
10 0.23
11 0.22
12 0.2
13 0.26
14 0.25
15 0.28
16 0.34
17 0.4
18 0.48
19 0.49
20 0.58
21 0.6
22 0.69
23 0.73
24 0.78
25 0.77
26 0.79
27 0.89
28 0.89
29 0.9
30 0.91
31 0.92
32 0.91
33 0.9
34 0.84
35 0.85
36 0.83
37 0.81
38 0.8
39 0.77
40 0.69
41 0.71
42 0.69
43 0.62
44 0.59
45 0.52
46 0.49
47 0.45
48 0.42
49 0.35
50 0.33
51 0.29
52 0.23
53 0.21
54 0.14
55 0.11
56 0.09
57 0.08
58 0.07
59 0.07
60 0.1
61 0.12
62 0.15
63 0.17
64 0.19
65 0.23
66 0.31
67 0.37
68 0.38
69 0.38
70 0.36
71 0.38
72 0.37
73 0.34
74 0.3
75 0.24
76 0.19
77 0.24
78 0.24
79 0.24
80 0.24
81 0.23
82 0.24
83 0.25
84 0.26
85 0.29
86 0.33
87 0.39
88 0.47
89 0.5
90 0.46
91 0.51
92 0.51
93 0.5
94 0.53
95 0.52
96 0.52
97 0.55
98 0.59
99 0.6
100 0.63
101 0.64
102 0.65
103 0.64
104 0.59
105 0.54
106 0.52
107 0.53
108 0.5
109 0.45
110 0.4
111 0.32
112 0.31
113 0.3
114 0.27
115 0.2
116 0.19
117 0.18
118 0.14
119 0.17
120 0.16
121 0.17
122 0.18
123 0.18
124 0.17
125 0.16
126 0.15
127 0.13
128 0.15
129 0.18
130 0.21
131 0.25
132 0.26
133 0.26
134 0.28
135 0.27
136 0.29
137 0.31
138 0.31
139 0.28
140 0.3
141 0.34
142 0.33
143 0.35
144 0.31
145 0.26
146 0.22
147 0.2
148 0.16
149 0.1
150 0.09
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.06
159 0.06
160 0.08
161 0.08
162 0.09
163 0.11
164 0.16
165 0.18
166 0.24
167 0.31
168 0.4
169 0.5
170 0.6
171 0.7
172 0.75
173 0.84
174 0.87
175 0.9
176 0.89
177 0.88
178 0.88
179 0.85
180 0.84
181 0.77
182 0.69
183 0.62
184 0.53
185 0.43