Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EG25

Protein Details
Accession R1EG25    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-77VPVMVARKRLRKHSKYKRGNLRLSNVLHydrophilic
NLS Segment(s)
PositionSequence
57-68RKRLRKHSKYKR
Subcellular Location(s) mito 13, cyto 7, cyto_nucl 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006016  UspA  
KEGG npa:UCRNP2_6532  -  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MITEVIDFLDPTLVILGSRGRSALKGLNIIPLANPVLLGSFSNYLVTKSSVPVMVARKRLRKHSKYKRGNLRLSNVLTNPASKLASAKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.11
9 0.13
10 0.17
11 0.16
12 0.18
13 0.18
14 0.22
15 0.21
16 0.21
17 0.19
18 0.16
19 0.14
20 0.11
21 0.1
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.08
30 0.08
31 0.08
32 0.08
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.13
40 0.18
41 0.21
42 0.29
43 0.34
44 0.4
45 0.43
46 0.53
47 0.6
48 0.64
49 0.71
50 0.74
51 0.8
52 0.83
53 0.9
54 0.91
55 0.9
56 0.9
57 0.85
58 0.8
59 0.77
60 0.7
61 0.65
62 0.54
63 0.49
64 0.41
65 0.36
66 0.3
67 0.25
68 0.22
69 0.17
70 0.19