Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EZ84

Protein Details
Accession R1EZ84    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
58-81RKDSACCPKKGEEKKKRWETTVKFBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 8, mito 7
Family & Domain DBs
KEGG npa:UCRNP2_134  -  
Amino Acid Sequences MTPTVAGYQAAYVHSPTVDPIGALRMQRACSLDTERRLYANRQQERACAAAADKQAPRKDSACCPKKGEEKKKRWETTVKFVDGSPRGKEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.09
6 0.08
7 0.08
8 0.1
9 0.12
10 0.12
11 0.15
12 0.15
13 0.16
14 0.18
15 0.19
16 0.17
17 0.18
18 0.24
19 0.27
20 0.29
21 0.31
22 0.29
23 0.3
24 0.31
25 0.32
26 0.33
27 0.37
28 0.37
29 0.38
30 0.37
31 0.37
32 0.37
33 0.35
34 0.27
35 0.17
36 0.13
37 0.14
38 0.14
39 0.17
40 0.16
41 0.21
42 0.24
43 0.25
44 0.27
45 0.25
46 0.28
47 0.34
48 0.43
49 0.45
50 0.46
51 0.49
52 0.54
53 0.62
54 0.69
55 0.71
56 0.72
57 0.74
58 0.81
59 0.88
60 0.85
61 0.82
62 0.81
63 0.77
64 0.77
65 0.75
66 0.67
67 0.57
68 0.53
69 0.55
70 0.51
71 0.48