Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EX46

Protein Details
Accession R1EX46    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
498-518RDAPRVTRSKRNAFVSKKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045175  M28_fam  
IPR041756  M28_SGAP-like  
IPR046450  PA_dom_sf  
IPR003137  PA_domain  
IPR007484  Peptidase_M28  
Gene Ontology GO:0004177  F:aminopeptidase activity  
GO:0046872  F:metal ion binding  
GO:0008235  F:metalloexopeptidase activity  
GO:0006508  P:proteolysis  
KEGG npa:UCRNP2_980  -  
Pfam View protein in Pfam  
PF02225  PA  
PF04389  Peptidase_M28  
CDD cd03876  M28_SGAP_like  
cd02130  PA_ScAPY_like  
Amino Acid Sequences MPSAFRTAATVGALAYVVAAAPNPYVWKPAPKPRDVWRPAVSSEELQASISGDALYEHEAQLQSFAYAYPDRNRLMGSQAHNDTVTYVYNTLTALDYYDVTLQPWSSIVQSSGEASLAIDDAAVDSATLMDYSPSGNVTAPLVAVSNQGCDTSDYPADVSGNIALISRGTCEFGLKSVYAGLAGAVGAIIYNNIDGDLQGTLGTPREEGPYVPTVGIPQALGLSLIDEIEAGDAPVGDIYTNTTIETVDTFNVLAQTKGGDQNNTLILSGHSDSVAAGPGINDDGSGSTGILEVAIQLANYTTTNSVRFAWWSGEEEGLLGSTYYVENLPAAELAKLRLMLDFDMIASPNYIYAVYDGDGSSFNISGPAGSAEAEALFEDYYTARGVNYTATAFDGRSDYGPFLDAGVASGGVFTGAEGIKTEAEAEAFGGEAGVAYDVNYHGAGDTLDNLDMTAFVLNTQAIAHAVATYATSFDSLNQDAAVARRGVEWRKPVLEGRDAPRVTRSKRNAFVSKKTGKLFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.1
11 0.1
12 0.15
13 0.18
14 0.27
15 0.34
16 0.45
17 0.52
18 0.54
19 0.6
20 0.65
21 0.74
22 0.69
23 0.7
24 0.66
25 0.62
26 0.58
27 0.57
28 0.5
29 0.41
30 0.38
31 0.32
32 0.26
33 0.22
34 0.21
35 0.17
36 0.14
37 0.13
38 0.1
39 0.07
40 0.07
41 0.08
42 0.11
43 0.11
44 0.11
45 0.14
46 0.14
47 0.14
48 0.15
49 0.14
50 0.11
51 0.1
52 0.1
53 0.11
54 0.13
55 0.17
56 0.21
57 0.26
58 0.27
59 0.27
60 0.28
61 0.26
62 0.28
63 0.31
64 0.3
65 0.33
66 0.34
67 0.35
68 0.34
69 0.33
70 0.29
71 0.24
72 0.2
73 0.14
74 0.12
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.08
82 0.09
83 0.09
84 0.09
85 0.12
86 0.11
87 0.11
88 0.12
89 0.1
90 0.1
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.11
98 0.12
99 0.11
100 0.11
101 0.09
102 0.08
103 0.08
104 0.07
105 0.06
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.04
117 0.03
118 0.04
119 0.05
120 0.05
121 0.06
122 0.06
123 0.07
124 0.07
125 0.08
126 0.08
127 0.07
128 0.07
129 0.07
130 0.07
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1
137 0.11
138 0.12
139 0.13
140 0.13
141 0.12
142 0.12
143 0.13
144 0.13
145 0.1
146 0.1
147 0.07
148 0.07
149 0.06
150 0.06
151 0.05
152 0.05
153 0.06
154 0.06
155 0.06
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.11
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.07
168 0.06
169 0.04
170 0.04
171 0.03
172 0.03
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.09
194 0.09
195 0.09
196 0.12
197 0.13
198 0.14
199 0.13
200 0.13
201 0.11
202 0.11
203 0.11
204 0.08
205 0.06
206 0.05
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.02
225 0.02
226 0.04
227 0.05
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.06
239 0.08
240 0.08
241 0.07
242 0.06
243 0.06
244 0.07
245 0.12
246 0.12
247 0.11
248 0.11
249 0.13
250 0.14
251 0.14
252 0.13
253 0.09
254 0.08
255 0.1
256 0.1
257 0.08
258 0.07
259 0.07
260 0.07
261 0.06
262 0.07
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.03
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.04
287 0.04
288 0.05
289 0.06
290 0.07
291 0.08
292 0.1
293 0.1
294 0.1
295 0.11
296 0.12
297 0.12
298 0.12
299 0.14
300 0.14
301 0.14
302 0.13
303 0.12
304 0.1
305 0.09
306 0.08
307 0.04
308 0.03
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.05
318 0.06
319 0.06
320 0.06
321 0.07
322 0.08
323 0.08
324 0.08
325 0.08
326 0.09
327 0.08
328 0.08
329 0.08
330 0.07
331 0.07
332 0.08
333 0.07
334 0.07
335 0.06
336 0.05
337 0.06
338 0.05
339 0.05
340 0.05
341 0.06
342 0.06
343 0.07
344 0.07
345 0.07
346 0.08
347 0.08
348 0.08
349 0.08
350 0.07
351 0.07
352 0.07
353 0.06
354 0.06
355 0.06
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.05
363 0.05
364 0.05
365 0.04
366 0.05
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.07
374 0.07
375 0.08
376 0.08
377 0.08
378 0.1
379 0.1
380 0.1
381 0.11
382 0.11
383 0.11
384 0.12
385 0.13
386 0.11
387 0.11
388 0.12
389 0.11
390 0.1
391 0.09
392 0.08
393 0.07
394 0.07
395 0.07
396 0.05
397 0.05
398 0.04
399 0.04
400 0.04
401 0.03
402 0.05
403 0.05
404 0.06
405 0.07
406 0.08
407 0.08
408 0.08
409 0.09
410 0.07
411 0.07
412 0.07
413 0.06
414 0.05
415 0.05
416 0.05
417 0.04
418 0.04
419 0.03
420 0.04
421 0.04
422 0.03
423 0.03
424 0.05
425 0.05
426 0.06
427 0.06
428 0.06
429 0.06
430 0.07
431 0.07
432 0.06
433 0.08
434 0.08
435 0.09
436 0.08
437 0.08
438 0.08
439 0.08
440 0.08
441 0.07
442 0.05
443 0.05
444 0.06
445 0.06
446 0.07
447 0.07
448 0.07
449 0.06
450 0.07
451 0.07
452 0.06
453 0.06
454 0.06
455 0.07
456 0.06
457 0.06
458 0.06
459 0.07
460 0.07
461 0.09
462 0.13
463 0.14
464 0.14
465 0.14
466 0.14
467 0.15
468 0.16
469 0.18
470 0.13
471 0.13
472 0.16
473 0.21
474 0.26
475 0.32
476 0.37
477 0.4
478 0.42
479 0.45
480 0.48
481 0.48
482 0.52
483 0.52
484 0.5
485 0.54
486 0.52
487 0.5
488 0.53
489 0.55
490 0.52
491 0.56
492 0.6
493 0.6
494 0.68
495 0.76
496 0.77
497 0.77
498 0.81
499 0.81
500 0.8
501 0.77