Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RJ69

Protein Details
Accession F4RJ69    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
39-65YLNKRYEKPYLKRRRLKSERHRMKFAIBasic
NLS Segment(s)
PositionSequence
47-60PYLKRRRLKSERHR
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_85562  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MRIPPTSFLSRPATTMDVERAYKRVQFMVNSAGLRKDIYLNKRYEKPYLKRRRLKSERHRMKFAIEVQRRVQLISVMKLKGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.26
4 0.23
5 0.25
6 0.25
7 0.24
8 0.24
9 0.25
10 0.24
11 0.24
12 0.22
13 0.21
14 0.21
15 0.23
16 0.25
17 0.23
18 0.22
19 0.19
20 0.17
21 0.16
22 0.14
23 0.15
24 0.16
25 0.21
26 0.27
27 0.3
28 0.33
29 0.39
30 0.41
31 0.43
32 0.47
33 0.5
34 0.55
35 0.63
36 0.7
37 0.73
38 0.78
39 0.83
40 0.83
41 0.86
42 0.86
43 0.86
44 0.87
45 0.85
46 0.83
47 0.73
48 0.67
49 0.63
50 0.6
51 0.6
52 0.54
53 0.53
54 0.49
55 0.54
56 0.51
57 0.44
58 0.37
59 0.31
60 0.3
61 0.31
62 0.34