Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EH33

Protein Details
Accession R1EH33    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
139-158RQKLQVTKRRVQYLRRKIKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG npa:UCRNP2_6452  -  
Amino Acid Sequences MPRAQARARAAKTADPGGRRRAQLQEQLKADQRELKAKIELVTILEEALDKEHEAVESWTKCLEDAQDFIREVDLEKAKIKKQICESLEIFPRRLTCPLMRRAVGFQEKIAESRGRVRDMMTDTQTKLGATRGRIDTVRQKLQVTKRRVQYLRRKIKASEKSFSSSARLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.46
4 0.48
5 0.51
6 0.49
7 0.49
8 0.49
9 0.51
10 0.55
11 0.57
12 0.57
13 0.54
14 0.56
15 0.59
16 0.53
17 0.48
18 0.45
19 0.4
20 0.4
21 0.39
22 0.38
23 0.34
24 0.34
25 0.33
26 0.27
27 0.25
28 0.18
29 0.18
30 0.14
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.07
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.14
44 0.14
45 0.15
46 0.15
47 0.14
48 0.14
49 0.14
50 0.15
51 0.1
52 0.11
53 0.12
54 0.15
55 0.15
56 0.15
57 0.15
58 0.13
59 0.12
60 0.15
61 0.14
62 0.13
63 0.16
64 0.19
65 0.2
66 0.26
67 0.26
68 0.26
69 0.3
70 0.37
71 0.34
72 0.37
73 0.36
74 0.35
75 0.41
76 0.37
77 0.33
78 0.26
79 0.27
80 0.23
81 0.23
82 0.22
83 0.2
84 0.25
85 0.31
86 0.34
87 0.33
88 0.33
89 0.33
90 0.36
91 0.36
92 0.3
93 0.24
94 0.23
95 0.23
96 0.23
97 0.24
98 0.18
99 0.15
100 0.22
101 0.26
102 0.24
103 0.24
104 0.24
105 0.26
106 0.3
107 0.34
108 0.29
109 0.29
110 0.28
111 0.29
112 0.29
113 0.24
114 0.2
115 0.2
116 0.2
117 0.18
118 0.24
119 0.25
120 0.27
121 0.28
122 0.32
123 0.37
124 0.41
125 0.46
126 0.42
127 0.42
128 0.47
129 0.57
130 0.61
131 0.6
132 0.6
133 0.61
134 0.69
135 0.72
136 0.75
137 0.76
138 0.78
139 0.81
140 0.8
141 0.76
142 0.71
143 0.76
144 0.77
145 0.72
146 0.69
147 0.63
148 0.61
149 0.6
150 0.56
151 0.51