Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5APB0

Protein Details
Accession Q5APB0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKIKKPKKNGPPPEGYSKIBasic
NLS Segment(s)
PositionSequence
4-10IKKPKKN
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
Gene Ontology GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0000974  C:Prp19 complex  
GO:0005681  C:spliceosomal complex  
GO:0005686  C:U2 snRNP  
GO:0005684  C:U2-type spliceosomal complex  
GO:0000282  P:cellular bud site selection  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG cal:CAALFM_C109880CA  -  
Pfam View protein in Pfam  
PF01125  G10  
Amino Acid Sequences MPKIKKPKKNGPPPEGYSKIEPTLTKYRNKLKSAQANPDPTKSKQSSLWIIYQLNYKITRYVYDTYVAKRISKELYDWLLLQNDINKDLIAKWKKPGYEKLCCINCISTNTNGGGTCVCRVPKAKLLEKDPEKVNIECITCGCRGCASSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.78
3 0.7
4 0.64
5 0.57
6 0.5
7 0.44
8 0.38
9 0.35
10 0.41
11 0.42
12 0.44
13 0.48
14 0.55
15 0.61
16 0.64
17 0.64
18 0.63
19 0.69
20 0.68
21 0.71
22 0.68
23 0.69
24 0.68
25 0.67
26 0.62
27 0.53
28 0.55
29 0.47
30 0.43
31 0.37
32 0.4
33 0.4
34 0.39
35 0.39
36 0.34
37 0.33
38 0.31
39 0.32
40 0.27
41 0.25
42 0.23
43 0.2
44 0.19
45 0.19
46 0.19
47 0.18
48 0.19
49 0.17
50 0.19
51 0.2
52 0.2
53 0.25
54 0.24
55 0.21
56 0.19
57 0.2
58 0.19
59 0.18
60 0.17
61 0.15
62 0.16
63 0.16
64 0.16
65 0.15
66 0.14
67 0.13
68 0.12
69 0.12
70 0.11
71 0.11
72 0.1
73 0.09
74 0.09
75 0.1
76 0.19
77 0.2
78 0.21
79 0.25
80 0.28
81 0.31
82 0.35
83 0.44
84 0.43
85 0.47
86 0.5
87 0.54
88 0.54
89 0.52
90 0.49
91 0.42
92 0.37
93 0.34
94 0.32
95 0.25
96 0.25
97 0.24
98 0.24
99 0.22
100 0.19
101 0.15
102 0.14
103 0.13
104 0.14
105 0.14
106 0.16
107 0.19
108 0.23
109 0.29
110 0.36
111 0.43
112 0.47
113 0.52
114 0.59
115 0.61
116 0.63
117 0.58
118 0.57
119 0.53
120 0.46
121 0.45
122 0.39
123 0.36
124 0.31
125 0.29
126 0.26
127 0.24
128 0.24
129 0.21
130 0.18