Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GRB6

Protein Details
Accession R1GRB6   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-78SVYWCPDGRRRKQEGPYKVIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046529  DUF6594  
Gene Ontology GO:0016020  C:membrane  
KEGG npa:UCRNP2_2458  -  
Pfam View protein in Pfam  
PF20237  DUF6594  
Amino Acid Sequences MSAAHEDSSTSNMKSVASEKVETPEPAGADERQDSPQTEENDAPWRRSNYTSLYRSGDSVYWCPDGRRRKQEGPYKVIAAPANGASELSVWHIQDSWIRRLPRRLTNLTIGSKEKEDVELNPQCIDYHPSGYPKLAAWLNSDENFLMCRRYGFLHSRVLLYRQDELRALEEDLLELDLEDKEADPRVHMSRVLDDSRNDERKKLIRKIDEKLKEYEEKFMDYDQDFVALVDPKEGGWFDAVLEDWFIPYVPRRISKIMFSDEAQRKSTADKHVNLYSKDRIDTFARILITIIAVALLMAPVVVLFNDEESGTVKIVVILAFTLGFSAALSVFTKAKRHEVFAATAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.25
5 0.26
6 0.26
7 0.3
8 0.33
9 0.31
10 0.31
11 0.26
12 0.23
13 0.23
14 0.24
15 0.2
16 0.2
17 0.22
18 0.23
19 0.23
20 0.25
21 0.24
22 0.27
23 0.32
24 0.32
25 0.33
26 0.32
27 0.31
28 0.39
29 0.39
30 0.37
31 0.37
32 0.38
33 0.38
34 0.4
35 0.41
36 0.4
37 0.47
38 0.47
39 0.46
40 0.46
41 0.43
42 0.42
43 0.4
44 0.34
45 0.28
46 0.27
47 0.26
48 0.25
49 0.25
50 0.26
51 0.32
52 0.4
53 0.45
54 0.53
55 0.57
56 0.63
57 0.72
58 0.79
59 0.8
60 0.78
61 0.72
62 0.66
63 0.58
64 0.53
65 0.45
66 0.36
67 0.28
68 0.22
69 0.18
70 0.14
71 0.13
72 0.09
73 0.08
74 0.08
75 0.09
76 0.1
77 0.09
78 0.1
79 0.1
80 0.11
81 0.15
82 0.2
83 0.23
84 0.27
85 0.31
86 0.34
87 0.42
88 0.48
89 0.52
90 0.56
91 0.54
92 0.52
93 0.56
94 0.59
95 0.53
96 0.5
97 0.44
98 0.37
99 0.33
100 0.3
101 0.24
102 0.2
103 0.18
104 0.16
105 0.22
106 0.24
107 0.24
108 0.24
109 0.23
110 0.21
111 0.2
112 0.23
113 0.15
114 0.15
115 0.16
116 0.18
117 0.18
118 0.19
119 0.19
120 0.15
121 0.18
122 0.16
123 0.15
124 0.15
125 0.18
126 0.2
127 0.2
128 0.2
129 0.16
130 0.15
131 0.15
132 0.13
133 0.1
134 0.08
135 0.07
136 0.08
137 0.1
138 0.14
139 0.18
140 0.21
141 0.25
142 0.26
143 0.27
144 0.27
145 0.28
146 0.25
147 0.22
148 0.23
149 0.18
150 0.18
151 0.17
152 0.17
153 0.17
154 0.15
155 0.14
156 0.11
157 0.1
158 0.09
159 0.08
160 0.07
161 0.05
162 0.04
163 0.04
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.07
170 0.07
171 0.07
172 0.1
173 0.11
174 0.12
175 0.13
176 0.13
177 0.15
178 0.18
179 0.2
180 0.2
181 0.18
182 0.23
183 0.3
184 0.36
185 0.34
186 0.31
187 0.34
188 0.39
189 0.47
190 0.49
191 0.49
192 0.51
193 0.56
194 0.62
195 0.67
196 0.67
197 0.62
198 0.58
199 0.55
200 0.52
201 0.47
202 0.46
203 0.38
204 0.32
205 0.29
206 0.26
207 0.26
208 0.2
209 0.2
210 0.14
211 0.13
212 0.11
213 0.1
214 0.12
215 0.1
216 0.1
217 0.09
218 0.09
219 0.08
220 0.09
221 0.09
222 0.08
223 0.06
224 0.06
225 0.06
226 0.06
227 0.07
228 0.06
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.08
236 0.13
237 0.16
238 0.19
239 0.23
240 0.28
241 0.3
242 0.34
243 0.37
244 0.36
245 0.35
246 0.33
247 0.39
248 0.42
249 0.44
250 0.41
251 0.36
252 0.32
253 0.34
254 0.39
255 0.39
256 0.38
257 0.39
258 0.42
259 0.48
260 0.53
261 0.52
262 0.51
263 0.48
264 0.44
265 0.42
266 0.37
267 0.34
268 0.32
269 0.32
270 0.29
271 0.27
272 0.24
273 0.22
274 0.22
275 0.18
276 0.15
277 0.12
278 0.09
279 0.05
280 0.04
281 0.04
282 0.04
283 0.03
284 0.02
285 0.02
286 0.02
287 0.02
288 0.03
289 0.03
290 0.04
291 0.04
292 0.05
293 0.06
294 0.06
295 0.07
296 0.09
297 0.1
298 0.1
299 0.1
300 0.09
301 0.09
302 0.1
303 0.1
304 0.08
305 0.07
306 0.07
307 0.07
308 0.06
309 0.06
310 0.05
311 0.05
312 0.04
313 0.05
314 0.05
315 0.07
316 0.08
317 0.1
318 0.13
319 0.16
320 0.22
321 0.24
322 0.34
323 0.35
324 0.39
325 0.44
326 0.44