Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EK61

Protein Details
Accession R1EK61    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-89LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
71-84PKKKTSHMKKRHRQ
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0016020  C:membrane  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_5310  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAALRSPHAPPLAALVAAARAPTGPLPLLRRLQQRPLLPLPLRIPAPAVAAAAAVSGLLAGVWESILRAVPKKKTSHMKKRHRQMAGKALKDVTEVVKCPGCGKPKRAHILCPYCMQSIQHWLKGNADLASKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.13
4 0.13
5 0.12
6 0.07
7 0.05
8 0.06
9 0.07
10 0.08
11 0.08
12 0.12
13 0.16
14 0.21
15 0.25
16 0.3
17 0.38
18 0.4
19 0.47
20 0.5
21 0.49
22 0.51
23 0.51
24 0.53
25 0.45
26 0.46
27 0.4
28 0.38
29 0.35
30 0.28
31 0.26
32 0.18
33 0.19
34 0.15
35 0.13
36 0.08
37 0.08
38 0.08
39 0.06
40 0.05
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.01
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.04
55 0.07
56 0.11
57 0.16
58 0.21
59 0.24
60 0.3
61 0.4
62 0.5
63 0.58
64 0.66
65 0.73
66 0.77
67 0.85
68 0.87
69 0.85
70 0.81
71 0.77
72 0.77
73 0.74
74 0.67
75 0.58
76 0.5
77 0.42
78 0.37
79 0.3
80 0.23
81 0.17
82 0.16
83 0.16
84 0.18
85 0.18
86 0.2
87 0.24
88 0.29
89 0.33
90 0.39
91 0.45
92 0.52
93 0.62
94 0.62
95 0.64
96 0.66
97 0.68
98 0.65
99 0.62
100 0.56
101 0.48
102 0.47
103 0.41
104 0.33
105 0.36
106 0.38
107 0.38
108 0.39
109 0.38
110 0.39
111 0.41
112 0.41
113 0.33