Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GH33

Protein Details
Accession R1GH33    Localization Confidence High Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
181-204DDESAPKLKRKKRKSDLKKDLEVSBasic
209-234SEAPAKEKSKSKKSKKSKDSEPSTDIHydrophilic
242-291AEGKDDKKARRDAKKARKLERLTKKESKKSKEKRREKKEKRKDSSSEDSSBasic
NLS Segment(s)
PositionSequence
173-199EKKRKRSEDDESAPKLKRKKRKSDLKK
212-226PAKEKSKSKKSKKSK
246-283DDKKARRDAKKARKLERLTKKESKKSKEKRREKKEKRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG npa:UCRNP2_5633  -  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MGLAGPKNRTKLSADPNNTHWSKSTDRFGHKILRKQGWTPGEYLGAKDAKHSSHYTAANASHIRVAVKDDNLGLGAKRGKAENETFGLSAFQGLLGRLNGKSDGELKKEESAQRDLKLQLYQNQRWGSIRFVSGGLLVGDKIEKLLEDDKVRGAQLARDPVLDSESADGEKTEKKRKRSEDDESAPKLKRKKRKSDLKKDLEVSSHDDSEAPAKEKSKSKKSKKSKDSEPSTDITAPSSTSAEGKDDKKARRDAKKARKLERLTKKESKKSKEKRREKKEKRKDSSSEDSSSEDEGTTSVSVSAPDSGTSTPAQSFAGGRLAVRQRYIAQKKKASMDPQALKEIFMIKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.61
4 0.68
5 0.63
6 0.55
7 0.48
8 0.43
9 0.43
10 0.45
11 0.49
12 0.48
13 0.54
14 0.57
15 0.59
16 0.63
17 0.63
18 0.66
19 0.65
20 0.66
21 0.63
22 0.62
23 0.66
24 0.63
25 0.57
26 0.5
27 0.43
28 0.4
29 0.37
30 0.34
31 0.31
32 0.27
33 0.25
34 0.26
35 0.27
36 0.22
37 0.27
38 0.28
39 0.27
40 0.31
41 0.33
42 0.32
43 0.33
44 0.32
45 0.33
46 0.31
47 0.28
48 0.23
49 0.22
50 0.2
51 0.17
52 0.22
53 0.2
54 0.2
55 0.21
56 0.19
57 0.18
58 0.19
59 0.19
60 0.13
61 0.14
62 0.16
63 0.16
64 0.17
65 0.18
66 0.19
67 0.23
68 0.26
69 0.26
70 0.25
71 0.25
72 0.24
73 0.23
74 0.21
75 0.16
76 0.14
77 0.09
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.09
84 0.09
85 0.1
86 0.11
87 0.1
88 0.12
89 0.17
90 0.2
91 0.22
92 0.24
93 0.25
94 0.27
95 0.31
96 0.33
97 0.31
98 0.34
99 0.34
100 0.33
101 0.35
102 0.34
103 0.32
104 0.32
105 0.3
106 0.31
107 0.36
108 0.37
109 0.4
110 0.4
111 0.39
112 0.37
113 0.36
114 0.32
115 0.25
116 0.24
117 0.18
118 0.17
119 0.16
120 0.13
121 0.13
122 0.1
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.06
132 0.08
133 0.11
134 0.12
135 0.13
136 0.14
137 0.15
138 0.15
139 0.14
140 0.12
141 0.12
142 0.14
143 0.17
144 0.16
145 0.16
146 0.16
147 0.15
148 0.16
149 0.13
150 0.1
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.07
157 0.11
158 0.15
159 0.24
160 0.29
161 0.35
162 0.44
163 0.51
164 0.58
165 0.61
166 0.65
167 0.65
168 0.66
169 0.67
170 0.63
171 0.6
172 0.54
173 0.5
174 0.5
175 0.47
176 0.51
177 0.53
178 0.61
179 0.67
180 0.76
181 0.84
182 0.87
183 0.91
184 0.89
185 0.86
186 0.77
187 0.69
188 0.6
189 0.5
190 0.44
191 0.36
192 0.28
193 0.22
194 0.18
195 0.17
196 0.18
197 0.18
198 0.15
199 0.14
200 0.15
201 0.2
202 0.27
203 0.35
204 0.42
205 0.51
206 0.59
207 0.69
208 0.78
209 0.85
210 0.88
211 0.89
212 0.89
213 0.88
214 0.86
215 0.82
216 0.75
217 0.66
218 0.59
219 0.51
220 0.41
221 0.32
222 0.23
223 0.17
224 0.14
225 0.13
226 0.1
227 0.1
228 0.1
229 0.11
230 0.15
231 0.17
232 0.24
233 0.3
234 0.35
235 0.41
236 0.49
237 0.56
238 0.61
239 0.7
240 0.73
241 0.77
242 0.82
243 0.85
244 0.84
245 0.86
246 0.83
247 0.83
248 0.83
249 0.8
250 0.79
251 0.8
252 0.81
253 0.8
254 0.83
255 0.81
256 0.81
257 0.84
258 0.86
259 0.88
260 0.9
261 0.91
262 0.93
263 0.95
264 0.96
265 0.96
266 0.96
267 0.96
268 0.94
269 0.93
270 0.88
271 0.85
272 0.84
273 0.79
274 0.71
275 0.61
276 0.55
277 0.46
278 0.41
279 0.32
280 0.22
281 0.16
282 0.12
283 0.12
284 0.1
285 0.08
286 0.08
287 0.07
288 0.08
289 0.08
290 0.1
291 0.09
292 0.09
293 0.11
294 0.11
295 0.13
296 0.13
297 0.14
298 0.13
299 0.13
300 0.14
301 0.13
302 0.14
303 0.13
304 0.17
305 0.15
306 0.15
307 0.22
308 0.28
309 0.29
310 0.3
311 0.31
312 0.31
313 0.42
314 0.52
315 0.54
316 0.56
317 0.62
318 0.67
319 0.72
320 0.75
321 0.71
322 0.69
323 0.7
324 0.69
325 0.65
326 0.68
327 0.6
328 0.53
329 0.48
330 0.43
331 0.33