Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GE91

Protein Details
Accession R1GE91   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-55EIARSVQHKLKRKAPRNQSILDNHydrophilic
NLS Segment(s)
PositionSequence
506-516KKTRARRREEK
Subcellular Location(s) nucl 15, cyto 5, mito 4, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039602  Rxt2  
IPR013904  RXT2_N  
Gene Ontology GO:0016575  P:histone deacetylation  
KEGG npa:UCRNP2_6706  -  
Pfam View protein in Pfam  
PF08595  RXT2_N  
Amino Acid Sequences MAGQQFVFAEAIIGMKKAVARYDASDEDDSAAEIARSVQHKLKRKAPRNQSILDNGRFMYKKPKIEHAGYRRHIIARNPPLIDEDGDEIEEVDDDESVDGSIAEDNPYGDIRLEELLAPLTSAADLATHPSMSIPYYSNHITELVNNSREVLQREEKSLWRAKAIMQKLLGDNTWLAVGEMETSYDREILSEPASGVAASTSTGSLEADSAERQGTSWEDPVKISEGTNMQGTPQAISEQQAQDADVQMENGADAQTAPSTNGDSTHHAELRRNAPSNGTNLDPKTDALGQTQQQEGTRQEGAEAERQTNGDVLKQEDQSASAGSSGDKMQVDGTNGTAEDGANEPRSPHSDDAEDTNSQHTSHRMTTRAQRRANSHTSSVPGSPRTLSPESPGEPPIHPLFKFPVENLVDRDMGLPASEAEDTRTWLLMYIQKQEEVVRQTRALYMGLMQADRKRKMVLKWAKAEGHVGEMSDGEDWVDKEEWGLTEDLVKGKEEEEEEGVAQAKKTRARRREEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.12
5 0.14
6 0.16
7 0.18
8 0.21
9 0.28
10 0.29
11 0.32
12 0.32
13 0.3
14 0.29
15 0.27
16 0.23
17 0.17
18 0.14
19 0.09
20 0.08
21 0.09
22 0.12
23 0.13
24 0.17
25 0.23
26 0.31
27 0.42
28 0.49
29 0.58
30 0.64
31 0.73
32 0.79
33 0.84
34 0.86
35 0.83
36 0.8
37 0.77
38 0.76
39 0.74
40 0.67
41 0.58
42 0.48
43 0.47
44 0.43
45 0.38
46 0.39
47 0.38
48 0.43
49 0.45
50 0.54
51 0.54
52 0.61
53 0.7
54 0.69
55 0.72
56 0.67
57 0.68
58 0.62
59 0.59
60 0.57
61 0.52
62 0.53
63 0.52
64 0.55
65 0.51
66 0.48
67 0.46
68 0.43
69 0.38
70 0.29
71 0.22
72 0.17
73 0.16
74 0.15
75 0.13
76 0.11
77 0.1
78 0.08
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.08
102 0.08
103 0.09
104 0.09
105 0.08
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.04
112 0.04
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.11
121 0.09
122 0.09
123 0.14
124 0.15
125 0.15
126 0.15
127 0.16
128 0.15
129 0.16
130 0.22
131 0.23
132 0.23
133 0.23
134 0.23
135 0.24
136 0.27
137 0.27
138 0.26
139 0.28
140 0.28
141 0.32
142 0.34
143 0.34
144 0.38
145 0.42
146 0.37
147 0.31
148 0.31
149 0.32
150 0.37
151 0.37
152 0.36
153 0.3
154 0.31
155 0.31
156 0.31
157 0.26
158 0.19
159 0.16
160 0.12
161 0.11
162 0.08
163 0.07
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.09
182 0.08
183 0.07
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.07
202 0.08
203 0.09
204 0.11
205 0.13
206 0.13
207 0.13
208 0.14
209 0.16
210 0.14
211 0.13
212 0.12
213 0.12
214 0.12
215 0.13
216 0.12
217 0.1
218 0.12
219 0.12
220 0.1
221 0.09
222 0.09
223 0.08
224 0.1
225 0.13
226 0.11
227 0.12
228 0.11
229 0.11
230 0.11
231 0.11
232 0.1
233 0.07
234 0.06
235 0.06
236 0.05
237 0.05
238 0.05
239 0.04
240 0.03
241 0.03
242 0.03
243 0.03
244 0.04
245 0.04
246 0.04
247 0.05
248 0.05
249 0.07
250 0.08
251 0.11
252 0.14
253 0.16
254 0.18
255 0.19
256 0.21
257 0.24
258 0.28
259 0.29
260 0.28
261 0.26
262 0.27
263 0.27
264 0.28
265 0.25
266 0.21
267 0.19
268 0.18
269 0.19
270 0.17
271 0.15
272 0.15
273 0.14
274 0.13
275 0.12
276 0.16
277 0.16
278 0.18
279 0.18
280 0.17
281 0.17
282 0.19
283 0.17
284 0.17
285 0.16
286 0.14
287 0.13
288 0.14
289 0.15
290 0.18
291 0.18
292 0.16
293 0.16
294 0.16
295 0.16
296 0.16
297 0.14
298 0.11
299 0.11
300 0.14
301 0.16
302 0.16
303 0.17
304 0.16
305 0.16
306 0.14
307 0.14
308 0.11
309 0.08
310 0.07
311 0.07
312 0.08
313 0.07
314 0.09
315 0.09
316 0.09
317 0.1
318 0.11
319 0.13
320 0.12
321 0.12
322 0.1
323 0.1
324 0.1
325 0.09
326 0.07
327 0.07
328 0.08
329 0.09
330 0.1
331 0.1
332 0.1
333 0.12
334 0.15
335 0.18
336 0.18
337 0.18
338 0.19
339 0.19
340 0.23
341 0.25
342 0.23
343 0.2
344 0.21
345 0.19
346 0.18
347 0.18
348 0.16
349 0.16
350 0.21
351 0.24
352 0.25
353 0.29
354 0.38
355 0.47
356 0.54
357 0.55
358 0.55
359 0.57
360 0.62
361 0.65
362 0.6
363 0.53
364 0.46
365 0.43
366 0.41
367 0.38
368 0.33
369 0.27
370 0.25
371 0.23
372 0.22
373 0.26
374 0.27
375 0.25
376 0.25
377 0.29
378 0.3
379 0.31
380 0.31
381 0.27
382 0.25
383 0.28
384 0.29
385 0.28
386 0.26
387 0.26
388 0.28
389 0.3
390 0.31
391 0.27
392 0.31
393 0.3
394 0.32
395 0.32
396 0.31
397 0.26
398 0.25
399 0.26
400 0.17
401 0.14
402 0.12
403 0.1
404 0.07
405 0.08
406 0.09
407 0.08
408 0.11
409 0.11
410 0.13
411 0.14
412 0.14
413 0.12
414 0.13
415 0.16
416 0.18
417 0.2
418 0.26
419 0.26
420 0.26
421 0.27
422 0.29
423 0.31
424 0.32
425 0.33
426 0.29
427 0.29
428 0.29
429 0.31
430 0.3
431 0.25
432 0.19
433 0.17
434 0.17
435 0.18
436 0.17
437 0.18
438 0.23
439 0.31
440 0.32
441 0.33
442 0.34
443 0.37
444 0.42
445 0.5
446 0.54
447 0.56
448 0.61
449 0.67
450 0.65
451 0.61
452 0.59
453 0.49
454 0.44
455 0.34
456 0.27
457 0.2
458 0.17
459 0.17
460 0.13
461 0.12
462 0.07
463 0.09
464 0.09
465 0.12
466 0.12
467 0.12
468 0.12
469 0.14
470 0.14
471 0.14
472 0.15
473 0.11
474 0.14
475 0.16
476 0.19
477 0.18
478 0.18
479 0.17
480 0.17
481 0.21
482 0.19
483 0.2
484 0.19
485 0.2
486 0.19
487 0.2
488 0.23
489 0.2
490 0.19
491 0.22
492 0.25
493 0.3
494 0.4
495 0.5
496 0.55