Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1E7B6

Protein Details
Accession R1E7B6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSRPQKLRQRQRLRAVDNVIHydrophilic
59-81FDRYEKKYRKGVHKLPKWTRVSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
KEGG npa:UCRNP2_9965  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSRPQKLRQRQRLRAVDNVIATVDKALAKQGVSTKKLDRWKDEMPTEPEMLARDKYTFFDRYEKKYRKGVHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.69
4 0.58
5 0.49
6 0.38
7 0.28
8 0.23
9 0.16
10 0.12
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.1
17 0.16
18 0.21
19 0.23
20 0.26
21 0.28
22 0.34
23 0.42
24 0.43
25 0.42
26 0.42
27 0.44
28 0.46
29 0.45
30 0.44
31 0.4
32 0.39
33 0.35
34 0.29
35 0.25
36 0.21
37 0.2
38 0.16
39 0.12
40 0.11
41 0.11
42 0.13
43 0.16
44 0.18
45 0.18
46 0.27
47 0.31
48 0.37
49 0.48
50 0.52
51 0.53
52 0.59
53 0.64
54 0.66
55 0.72
56 0.74
57 0.74
58 0.77
59 0.83
60 0.84
61 0.86
62 0.82
63 0.8
64 0.8
65 0.79
66 0.79
67 0.77
68 0.79