Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GIW6

Protein Details
Accession R1GIW6   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-145ETLREEAKKGKRKDERPKDERKDERVSKKAKBasic
NLS Segment(s)
PositionSequence
121-148AKKGKRKDERPKDERKDERVSKKAKSTK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
KEGG npa:UCRNP2_4984  -  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MTEPRMRMRQKGQQFDTRDLEAYLIAFGDDRNPLPETVRVLDEIITDFIIETCHEAALCASYSRRAKIKVDDFKFILRKDPVKLGRVTELLNKEKEIKSQRKVFAVDDEQIGKDETLREEAKKGKRKDERPKDERKDERVSKKAKSTKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.67
4 0.59
5 0.5
6 0.4
7 0.34
8 0.26
9 0.2
10 0.14
11 0.09
12 0.07
13 0.06
14 0.05
15 0.07
16 0.08
17 0.08
18 0.11
19 0.12
20 0.13
21 0.15
22 0.17
23 0.19
24 0.19
25 0.19
26 0.18
27 0.17
28 0.17
29 0.15
30 0.14
31 0.11
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.06
47 0.06
48 0.12
49 0.14
50 0.16
51 0.19
52 0.21
53 0.23
54 0.3
55 0.39
56 0.43
57 0.44
58 0.45
59 0.43
60 0.45
61 0.46
62 0.38
63 0.34
64 0.27
65 0.27
66 0.25
67 0.32
68 0.31
69 0.31
70 0.32
71 0.29
72 0.29
73 0.28
74 0.27
75 0.25
76 0.27
77 0.27
78 0.26
79 0.26
80 0.27
81 0.27
82 0.33
83 0.37
84 0.39
85 0.43
86 0.5
87 0.53
88 0.52
89 0.54
90 0.49
91 0.46
92 0.42
93 0.36
94 0.3
95 0.28
96 0.24
97 0.23
98 0.22
99 0.15
100 0.12
101 0.13
102 0.12
103 0.16
104 0.17
105 0.18
106 0.22
107 0.3
108 0.39
109 0.46
110 0.5
111 0.55
112 0.63
113 0.73
114 0.8
115 0.83
116 0.84
117 0.84
118 0.91
119 0.9
120 0.91
121 0.89
122 0.85
123 0.85
124 0.83
125 0.85
126 0.83
127 0.79
128 0.76
129 0.77