Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RKF6

Protein Details
Accession F4RKF6   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
273-315EYSVPAKKTKTRAPPKPTGAPASQPAKRPRAPRARRGAGPEKVHydrophilic
NLS Segment(s)
PositionSequence
279-311KKTKTRAPPKPTGAPASQPAKRPRAPRARRGAG
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_86004  -  
Amino Acid Sequences MSDEDSVTGHGIYLSSNFEIEEKITPEQPQRETQYRTYVLSIPCSGADRDRCFTYEIRATGFSGKNLKLIPKNIYHLRGAFFPRNLLDTSGDQLFFEASDRGVITNGKSFPYSLIDNVGITGLGRISKITTTVETSIQHMIPKNPNKDKVTTIVTVEHSDYHPESKSAKVVKEGRECLFHGYIKDLNEITNCYVVIVSRVSPTSGHVEPSEMTTEPGIKARPADTKGNQNPNKPVNIPFGPSDFAETSFSSASSRSQTSSSKDKVQDEDIEEEYSVPAKKTKTRAPPKPTGAPASQPAKRPRAPRARRGAGPEKVLDIALDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.12
6 0.12
7 0.14
8 0.16
9 0.16
10 0.18
11 0.21
12 0.24
13 0.31
14 0.36
15 0.39
16 0.42
17 0.47
18 0.52
19 0.55
20 0.56
21 0.58
22 0.54
23 0.52
24 0.48
25 0.46
26 0.4
27 0.39
28 0.36
29 0.28
30 0.26
31 0.26
32 0.24
33 0.25
34 0.3
35 0.31
36 0.33
37 0.34
38 0.34
39 0.34
40 0.34
41 0.34
42 0.33
43 0.29
44 0.29
45 0.28
46 0.28
47 0.33
48 0.33
49 0.3
50 0.3
51 0.29
52 0.29
53 0.3
54 0.35
55 0.33
56 0.36
57 0.38
58 0.36
59 0.43
60 0.45
61 0.47
62 0.43
63 0.4
64 0.37
65 0.37
66 0.38
67 0.36
68 0.31
69 0.3
70 0.28
71 0.28
72 0.27
73 0.24
74 0.2
75 0.17
76 0.19
77 0.18
78 0.17
79 0.15
80 0.14
81 0.12
82 0.1
83 0.1
84 0.07
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.09
92 0.13
93 0.14
94 0.14
95 0.14
96 0.14
97 0.14
98 0.17
99 0.17
100 0.12
101 0.14
102 0.13
103 0.13
104 0.13
105 0.11
106 0.08
107 0.07
108 0.06
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.07
116 0.08
117 0.08
118 0.1
119 0.12
120 0.14
121 0.14
122 0.16
123 0.17
124 0.16
125 0.17
126 0.16
127 0.19
128 0.25
129 0.31
130 0.38
131 0.41
132 0.47
133 0.47
134 0.48
135 0.46
136 0.42
137 0.39
138 0.32
139 0.28
140 0.24
141 0.23
142 0.21
143 0.19
144 0.16
145 0.12
146 0.13
147 0.13
148 0.12
149 0.11
150 0.11
151 0.12
152 0.12
153 0.16
154 0.18
155 0.18
156 0.23
157 0.28
158 0.34
159 0.39
160 0.42
161 0.38
162 0.38
163 0.38
164 0.35
165 0.31
166 0.26
167 0.19
168 0.19
169 0.2
170 0.18
171 0.19
172 0.15
173 0.14
174 0.14
175 0.15
176 0.13
177 0.11
178 0.1
179 0.08
180 0.08
181 0.08
182 0.08
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.11
190 0.14
191 0.14
192 0.15
193 0.14
194 0.15
195 0.15
196 0.16
197 0.16
198 0.12
199 0.12
200 0.1
201 0.12
202 0.11
203 0.13
204 0.12
205 0.11
206 0.12
207 0.14
208 0.2
209 0.22
210 0.29
211 0.3
212 0.4
213 0.47
214 0.57
215 0.59
216 0.58
217 0.62
218 0.58
219 0.59
220 0.51
221 0.46
222 0.43
223 0.4
224 0.37
225 0.31
226 0.29
227 0.26
228 0.24
229 0.25
230 0.19
231 0.19
232 0.19
233 0.17
234 0.17
235 0.16
236 0.16
237 0.12
238 0.12
239 0.13
240 0.14
241 0.15
242 0.15
243 0.18
244 0.22
245 0.26
246 0.35
247 0.37
248 0.41
249 0.45
250 0.48
251 0.48
252 0.49
253 0.49
254 0.44
255 0.43
256 0.37
257 0.33
258 0.29
259 0.26
260 0.21
261 0.19
262 0.16
263 0.13
264 0.15
265 0.18
266 0.25
267 0.32
268 0.41
269 0.49
270 0.59
271 0.69
272 0.74
273 0.8
274 0.81
275 0.83
276 0.79
277 0.74
278 0.67
279 0.62
280 0.6
281 0.59
282 0.55
283 0.55
284 0.57
285 0.6
286 0.62
287 0.64
288 0.67
289 0.7
290 0.75
291 0.77
292 0.79
293 0.79
294 0.79
295 0.81
296 0.8
297 0.75
298 0.72
299 0.63
300 0.55
301 0.47
302 0.42