Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EXT6

Protein Details
Accession R1EXT6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-52VTKYSILKRKTTKDRKRQPATSDPAHydrophilic
NLS Segment(s)
PositionSequence
142-159PDSKPAQGGGKKKKKGKK
Subcellular Location(s) nucl 11.5, mito_nucl 10, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG npa:UCRNP2_648  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFTTSAEWYEQSKLLLEARPTTARVVTKYSILKRKTTKDRKRQPATSDPAAAAQTPAAQAPAAPQAALILKTYDPASGVCLKYQTTKAAEVGRLIASLEKLSRTMAALPDVSDDVAMLDAPAAEQGTGTNTPNPEPAAKPDSKPAQGGGKKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.22
5 0.22
6 0.22
7 0.26
8 0.27
9 0.27
10 0.27
11 0.28
12 0.27
13 0.27
14 0.29
15 0.26
16 0.29
17 0.35
18 0.41
19 0.46
20 0.46
21 0.51
22 0.53
23 0.62
24 0.67
25 0.72
26 0.75
27 0.77
28 0.85
29 0.89
30 0.91
31 0.88
32 0.84
33 0.82
34 0.79
35 0.72
36 0.63
37 0.52
38 0.44
39 0.38
40 0.3
41 0.21
42 0.13
43 0.09
44 0.08
45 0.07
46 0.06
47 0.05
48 0.05
49 0.06
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.09
58 0.06
59 0.06
60 0.07
61 0.08
62 0.07
63 0.07
64 0.06
65 0.09
66 0.11
67 0.12
68 0.11
69 0.12
70 0.13
71 0.15
72 0.16
73 0.17
74 0.15
75 0.16
76 0.18
77 0.19
78 0.19
79 0.17
80 0.17
81 0.14
82 0.12
83 0.11
84 0.09
85 0.07
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.09
94 0.1
95 0.11
96 0.11
97 0.11
98 0.12
99 0.11
100 0.11
101 0.09
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.03
113 0.04
114 0.04
115 0.08
116 0.1
117 0.11
118 0.14
119 0.15
120 0.16
121 0.18
122 0.2
123 0.2
124 0.2
125 0.25
126 0.29
127 0.31
128 0.32
129 0.39
130 0.44
131 0.44
132 0.43
133 0.41
134 0.44
135 0.48
136 0.56
137 0.59
138 0.62
139 0.68