Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GDN3

Protein Details
Accession R1GDN3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-32PDPTIRQKYISERNKRLRPDGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 8, mito 6, pero 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0004497  F:monooxygenase activity  
KEGG npa:UCRNP2_6905  -  
Pfam View protein in Pfam  
PF13450  NAD_binding_8  
Amino Acid Sequences MVTVDPGVAAPDPTIRQKYISERNKRLRPDGTAQFTPLASTPRLSHLATDPWAAHPTLNATPPALRPGDAIKFLILGAGFGGLLFAVRLVRAGFPAAAIRFVDDAAGFGGTWYWNRYPGLMCDVESYIYMPLLEETGYAPRRKYARGAELREHAERIAEVWGLADKALWRARCRGAVWDEGARRWAVRVVEGRGPGEAEREVVVSAQYVFAAGGTLNAPQVPRLEGLSAFRGSCFHTSRWDYGVTGGSPEEWELEKLRDKRVGIIGTGATAVQVVPQLARWAKELYVFQRTPASVDVRGQRPTDPEEWATKIAVEKGWQRARSENFNSYLMGAPKGEDLVNDAWCRMPSYSGIIGAPGNGIVTPDKIPEHLARLHELDLERAERVRARVDEIVKDKETAKKLHFYYPSWCKRSVADFLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.28
4 0.33
5 0.42
6 0.49
7 0.56
8 0.6
9 0.66
10 0.76
11 0.81
12 0.83
13 0.81
14 0.76
15 0.74
16 0.72
17 0.71
18 0.68
19 0.62
20 0.58
21 0.52
22 0.45
23 0.39
24 0.32
25 0.27
26 0.2
27 0.2
28 0.19
29 0.23
30 0.27
31 0.25
32 0.26
33 0.26
34 0.3
35 0.29
36 0.31
37 0.26
38 0.25
39 0.27
40 0.25
41 0.21
42 0.17
43 0.2
44 0.2
45 0.22
46 0.2
47 0.19
48 0.21
49 0.22
50 0.26
51 0.22
52 0.19
53 0.18
54 0.23
55 0.26
56 0.25
57 0.25
58 0.2
59 0.2
60 0.19
61 0.19
62 0.13
63 0.08
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.05
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.11
88 0.11
89 0.11
90 0.08
91 0.08
92 0.07
93 0.07
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.1
100 0.1
101 0.13
102 0.14
103 0.15
104 0.16
105 0.18
106 0.22
107 0.19
108 0.19
109 0.18
110 0.19
111 0.17
112 0.16
113 0.15
114 0.09
115 0.09
116 0.08
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.12
124 0.15
125 0.17
126 0.17
127 0.21
128 0.24
129 0.25
130 0.3
131 0.31
132 0.38
133 0.45
134 0.5
135 0.5
136 0.53
137 0.55
138 0.51
139 0.44
140 0.34
141 0.26
142 0.2
143 0.16
144 0.12
145 0.08
146 0.07
147 0.06
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.09
154 0.13
155 0.15
156 0.16
157 0.21
158 0.23
159 0.26
160 0.26
161 0.28
162 0.28
163 0.29
164 0.29
165 0.3
166 0.29
167 0.26
168 0.26
169 0.2
170 0.17
171 0.15
172 0.16
173 0.1
174 0.13
175 0.16
176 0.18
177 0.21
178 0.22
179 0.22
180 0.19
181 0.19
182 0.16
183 0.14
184 0.11
185 0.08
186 0.07
187 0.07
188 0.07
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.03
198 0.04
199 0.03
200 0.03
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.1
214 0.12
215 0.12
216 0.11
217 0.11
218 0.11
219 0.12
220 0.16
221 0.17
222 0.15
223 0.2
224 0.23
225 0.25
226 0.26
227 0.25
228 0.21
229 0.2
230 0.21
231 0.15
232 0.13
233 0.11
234 0.09
235 0.09
236 0.08
237 0.08
238 0.07
239 0.08
240 0.08
241 0.11
242 0.18
243 0.2
244 0.23
245 0.26
246 0.26
247 0.28
248 0.32
249 0.31
250 0.24
251 0.24
252 0.2
253 0.17
254 0.17
255 0.12
256 0.07
257 0.06
258 0.06
259 0.04
260 0.05
261 0.04
262 0.04
263 0.05
264 0.09
265 0.1
266 0.11
267 0.13
268 0.14
269 0.14
270 0.17
271 0.2
272 0.2
273 0.28
274 0.27
275 0.26
276 0.29
277 0.29
278 0.27
279 0.27
280 0.26
281 0.19
282 0.23
283 0.29
284 0.28
285 0.32
286 0.31
287 0.3
288 0.3
289 0.33
290 0.31
291 0.28
292 0.27
293 0.27
294 0.29
295 0.28
296 0.26
297 0.22
298 0.21
299 0.19
300 0.18
301 0.17
302 0.2
303 0.28
304 0.34
305 0.36
306 0.37
307 0.43
308 0.46
309 0.52
310 0.53
311 0.49
312 0.45
313 0.44
314 0.42
315 0.36
316 0.35
317 0.27
318 0.23
319 0.17
320 0.15
321 0.14
322 0.15
323 0.13
324 0.09
325 0.12
326 0.13
327 0.17
328 0.17
329 0.17
330 0.17
331 0.17
332 0.2
333 0.16
334 0.15
335 0.12
336 0.18
337 0.19
338 0.19
339 0.18
340 0.17
341 0.17
342 0.16
343 0.15
344 0.09
345 0.08
346 0.06
347 0.07
348 0.07
349 0.09
350 0.1
351 0.12
352 0.13
353 0.13
354 0.17
355 0.19
356 0.23
357 0.25
358 0.27
359 0.28
360 0.3
361 0.3
362 0.3
363 0.28
364 0.26
365 0.25
366 0.24
367 0.22
368 0.2
369 0.22
370 0.21
371 0.23
372 0.27
373 0.26
374 0.29
375 0.35
376 0.38
377 0.43
378 0.45
379 0.5
380 0.44
381 0.45
382 0.43
383 0.44
384 0.46
385 0.44
386 0.44
387 0.46
388 0.48
389 0.55
390 0.56
391 0.52
392 0.56
393 0.6
394 0.66
395 0.62
396 0.61
397 0.54
398 0.53
399 0.56
400 0.54