Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R458

Protein Details
Accession F4R458    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
80-100ASSEKKKMIQVKKKHPFKSHEBasic
NLS Segment(s)
PositionSequence
85-100KKMIQVKKKHPFKSHE
Subcellular Location(s) mito 16.5, cyto_mito 10.666, cyto_nucl 4.833, nucl 4, cyto 3.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_101262  -  
Amino Acid Sequences MVALRLLKFTFVLTAFSYVAIGGLSVDKLIKVDCMETHFAESEIFSEPEFPGEEALVRQREKLTHRPFKIGVMAPEVCAASSEKKKMIQVKKKHPFKSHESNKKASHPGSLLKEDIVFKKSTLNPNIVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.15
5 0.11
6 0.11
7 0.08
8 0.07
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.13
22 0.16
23 0.16
24 0.18
25 0.17
26 0.16
27 0.15
28 0.14
29 0.11
30 0.11
31 0.1
32 0.08
33 0.1
34 0.09
35 0.1
36 0.11
37 0.1
38 0.07
39 0.07
40 0.08
41 0.07
42 0.11
43 0.13
44 0.13
45 0.13
46 0.14
47 0.18
48 0.22
49 0.32
50 0.38
51 0.43
52 0.44
53 0.47
54 0.47
55 0.45
56 0.45
57 0.37
58 0.28
59 0.24
60 0.23
61 0.19
62 0.19
63 0.18
64 0.12
65 0.11
66 0.11
67 0.12
68 0.15
69 0.17
70 0.18
71 0.21
72 0.25
73 0.34
74 0.43
75 0.48
76 0.54
77 0.64
78 0.72
79 0.8
80 0.84
81 0.82
82 0.78
83 0.77
84 0.78
85 0.78
86 0.78
87 0.75
88 0.75
89 0.72
90 0.73
91 0.71
92 0.61
93 0.55
94 0.48
95 0.49
96 0.48
97 0.46
98 0.39
99 0.33
100 0.35
101 0.33
102 0.33
103 0.29
104 0.24
105 0.2
106 0.28
107 0.34
108 0.4
109 0.41
110 0.42