Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EWH0

Protein Details
Accession R1EWH0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-99EGYKKKKEMFQKEQKEWDKEKKKREKDGTSIQPTTBasic
NLS Segment(s)
PositionSequence
69-90KKKEMFQKEQKEWDKEKKKREK
Subcellular Location(s) nucl 15, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
KEGG npa:UCRNP2_1084  -  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MDMCRKFIQMGMTRAKRYANHAGGRKYSKANGAELPKSSTHKDAKDKLEASEIFREVWNQCRDHEGYKKKKEMFQKEQKEWDKEKKKREKDGTSIQPTTPKLQRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.45
4 0.45
5 0.48
6 0.45
7 0.47
8 0.52
9 0.55
10 0.58
11 0.6
12 0.57
13 0.49
14 0.44
15 0.43
16 0.38
17 0.36
18 0.35
19 0.36
20 0.35
21 0.33
22 0.34
23 0.29
24 0.3
25 0.29
26 0.3
27 0.29
28 0.32
29 0.39
30 0.43
31 0.45
32 0.48
33 0.47
34 0.42
35 0.43
36 0.38
37 0.33
38 0.3
39 0.26
40 0.2
41 0.19
42 0.2
43 0.15
44 0.22
45 0.22
46 0.2
47 0.2
48 0.23
49 0.25
50 0.28
51 0.36
52 0.39
53 0.45
54 0.53
55 0.6
56 0.59
57 0.63
58 0.68
59 0.7
60 0.7
61 0.71
62 0.73
63 0.72
64 0.79
65 0.8
66 0.78
67 0.74
68 0.75
69 0.75
70 0.72
71 0.77
72 0.78
73 0.8
74 0.84
75 0.87
76 0.85
77 0.83
78 0.86
79 0.85
80 0.83
81 0.77
82 0.67
83 0.64
84 0.58
85 0.56
86 0.52