Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EBU5

Protein Details
Accession R1EBU5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-48GQNVRKKRTAVSCDRCKNRKTKVRAPAPLLHydrophilic
72-92INAPCKTDLNRRKKRPYYHVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG npa:UCRNP2_8343  -  
Amino Acid Sequences MPPAPGPSASAPPAAKSTGQNVRKKRTAVSCDRCKNRKTKVRAPAPLLDTDGPPLTLRRGAMPGPCQYCASINAPCKTDLNRRKKRPYYHVSEEEYRCMTDILRHYLPDLQFNLPSLKALCARLEGLEGAAAHELPDGCETPATPADDDDDDEAPAAGRESPTIQEIQALQEQLGCLMIDSRGNYRRCPPAPPTRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.29
5 0.34
6 0.43
7 0.49
8 0.55
9 0.62
10 0.66
11 0.66
12 0.65
13 0.65
14 0.66
15 0.69
16 0.7
17 0.72
18 0.76
19 0.84
20 0.83
21 0.79
22 0.79
23 0.79
24 0.78
25 0.76
26 0.76
27 0.77
28 0.8
29 0.82
30 0.79
31 0.75
32 0.68
33 0.6
34 0.54
35 0.44
36 0.34
37 0.29
38 0.24
39 0.17
40 0.15
41 0.14
42 0.12
43 0.13
44 0.13
45 0.12
46 0.14
47 0.16
48 0.19
49 0.22
50 0.26
51 0.27
52 0.28
53 0.26
54 0.24
55 0.24
56 0.23
57 0.22
58 0.22
59 0.25
60 0.26
61 0.27
62 0.27
63 0.27
64 0.28
65 0.36
66 0.4
67 0.46
68 0.54
69 0.61
70 0.71
71 0.77
72 0.81
73 0.81
74 0.79
75 0.77
76 0.75
77 0.73
78 0.67
79 0.66
80 0.59
81 0.51
82 0.44
83 0.34
84 0.26
85 0.19
86 0.15
87 0.12
88 0.14
89 0.17
90 0.17
91 0.17
92 0.17
93 0.21
94 0.21
95 0.21
96 0.2
97 0.16
98 0.16
99 0.17
100 0.17
101 0.14
102 0.14
103 0.11
104 0.11
105 0.12
106 0.13
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.1
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.06
119 0.05
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.1
129 0.13
130 0.14
131 0.13
132 0.12
133 0.15
134 0.15
135 0.16
136 0.15
137 0.13
138 0.11
139 0.11
140 0.11
141 0.09
142 0.08
143 0.08
144 0.06
145 0.06
146 0.07
147 0.09
148 0.1
149 0.12
150 0.13
151 0.12
152 0.13
153 0.14
154 0.17
155 0.18
156 0.17
157 0.15
158 0.16
159 0.16
160 0.13
161 0.14
162 0.1
163 0.07
164 0.07
165 0.08
166 0.09
167 0.11
168 0.18
169 0.25
170 0.27
171 0.31
172 0.37
173 0.46
174 0.45
175 0.51
176 0.52
177 0.56