Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RYK5

Protein Details
Accession F4RYK5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-83AQPPPNPKIKPQKPRKAATAKNHydrophilic
NLS Segment(s)
PositionSequence
68-78PKIKPQKPRKA
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG mlr:MELLADRAFT_91309  -  
Amino Acid Sequences MGTESALVTPRRVANSSTTTATKADFPEQGPKISSHQLPIQTQCTMPTPPRCLATYPHARWAQPPPNPKIKPQKPRKAATAKNSTDIKHTKTTFIPLKHVETSPSFNIQFNQPLTRPDVTGTHSTVSSITTNTIDSMIANIPRRPHAMSPGRQHKALTLTDAILSDLDSLPTGPHVPTITNPEIPNLPTLFTCEQQVSANIYHAHFEAIPHIALVTSDKPVQSPDGLYASVLMQTYELAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.37
4 0.37
5 0.35
6 0.33
7 0.32
8 0.31
9 0.27
10 0.25
11 0.25
12 0.24
13 0.25
14 0.33
15 0.34
16 0.35
17 0.33
18 0.32
19 0.32
20 0.35
21 0.34
22 0.29
23 0.32
24 0.35
25 0.37
26 0.4
27 0.38
28 0.34
29 0.33
30 0.31
31 0.29
32 0.26
33 0.29
34 0.32
35 0.33
36 0.34
37 0.37
38 0.36
39 0.35
40 0.36
41 0.39
42 0.43
43 0.4
44 0.46
45 0.46
46 0.45
47 0.46
48 0.52
49 0.51
50 0.47
51 0.52
52 0.5
53 0.58
54 0.59
55 0.64
56 0.66
57 0.67
58 0.71
59 0.74
60 0.79
61 0.77
62 0.8
63 0.81
64 0.8
65 0.78
66 0.76
67 0.76
68 0.67
69 0.65
70 0.62
71 0.54
72 0.5
73 0.47
74 0.42
75 0.39
76 0.38
77 0.34
78 0.32
79 0.39
80 0.38
81 0.36
82 0.37
83 0.32
84 0.35
85 0.34
86 0.34
87 0.29
88 0.25
89 0.27
90 0.23
91 0.24
92 0.21
93 0.19
94 0.2
95 0.19
96 0.21
97 0.18
98 0.19
99 0.16
100 0.17
101 0.2
102 0.2
103 0.18
104 0.15
105 0.16
106 0.16
107 0.18
108 0.17
109 0.14
110 0.13
111 0.13
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.07
118 0.08
119 0.08
120 0.08
121 0.07
122 0.06
123 0.07
124 0.08
125 0.1
126 0.12
127 0.13
128 0.14
129 0.16
130 0.18
131 0.19
132 0.18
133 0.25
134 0.31
135 0.36
136 0.45
137 0.53
138 0.54
139 0.52
140 0.51
141 0.45
142 0.41
143 0.35
144 0.28
145 0.19
146 0.18
147 0.17
148 0.17
149 0.15
150 0.1
151 0.1
152 0.08
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.06
161 0.08
162 0.09
163 0.09
164 0.11
165 0.19
166 0.21
167 0.24
168 0.24
169 0.24
170 0.25
171 0.25
172 0.27
173 0.2
174 0.17
175 0.14
176 0.19
177 0.19
178 0.18
179 0.2
180 0.17
181 0.18
182 0.18
183 0.2
184 0.18
185 0.17
186 0.2
187 0.2
188 0.19
189 0.19
190 0.18
191 0.18
192 0.14
193 0.14
194 0.13
195 0.13
196 0.13
197 0.11
198 0.11
199 0.09
200 0.09
201 0.12
202 0.11
203 0.13
204 0.15
205 0.15
206 0.16
207 0.18
208 0.2
209 0.19
210 0.18
211 0.19
212 0.2
213 0.2
214 0.19
215 0.18
216 0.16
217 0.16
218 0.15
219 0.11
220 0.08