Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GFH9

Protein Details
Accession R1GFH9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
103-123QIVNADKKHKQKPYVERTPAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR020592  Ribosomal_S16_CS  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_2849  -  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MVLKIRLARFGKRHAPFYNIVVAHARTARDSKPLEVLGTYDPIPKAPKPGDVNGRPYKDIKLDRSRAQYWLGVGAQPSDTCWRLLSMTGLLEPKYRVGQIQEQIVNADKKHKQKPYVERTPAGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.52
4 0.49
5 0.49
6 0.39
7 0.36
8 0.32
9 0.29
10 0.27
11 0.26
12 0.24
13 0.18
14 0.21
15 0.21
16 0.24
17 0.25
18 0.24
19 0.27
20 0.27
21 0.25
22 0.22
23 0.23
24 0.17
25 0.17
26 0.16
27 0.14
28 0.13
29 0.14
30 0.17
31 0.15
32 0.2
33 0.19
34 0.25
35 0.26
36 0.31
37 0.39
38 0.4
39 0.48
40 0.49
41 0.5
42 0.44
43 0.42
44 0.38
45 0.36
46 0.36
47 0.35
48 0.37
49 0.39
50 0.42
51 0.47
52 0.47
53 0.42
54 0.4
55 0.33
56 0.25
57 0.23
58 0.19
59 0.13
60 0.12
61 0.11
62 0.1
63 0.09
64 0.1
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.12
72 0.12
73 0.1
74 0.1
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.14
81 0.14
82 0.14
83 0.13
84 0.16
85 0.23
86 0.25
87 0.31
88 0.31
89 0.3
90 0.31
91 0.34
92 0.32
93 0.26
94 0.31
95 0.31
96 0.38
97 0.47
98 0.53
99 0.57
100 0.64
101 0.74
102 0.77
103 0.81
104 0.8
105 0.75