Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EQQ1

Protein Details
Accession R1EQQ1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
36-56LLPPLRPPPRPRKRPGALPSSHydrophilic
NLS Segment(s)
PositionSequence
41-51RPPPRPRKRPG
Subcellular Location(s) extr 17, plas 6, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013969  Oligosacch_biosynth_Alg14  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0016740  F:transferase activity  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
KEGG npa:UCRNP2_3133  -  
Pfam View protein in Pfam  
PF08660  Alg14  
Amino Acid Sequences MTATTPPPPPSLLFFNGLLILAFLSIPFLALRILFLLPPLRPPPRPRKRPGALPSSNPKPSTPSTPEAASDPDDDAAPAPPTHLVVVLGSGGHTAEMLAMLRGVDRATFLASWTRRTYVVSAGDALSAERARDFEASLAASSATTSSYAVRTVPRARRVHQPLLSTPLSALRCLAAVFALLCDGPAPPDLVLTNGPGTGVVVVLAALLWRFVDVGDVAGTSRVRTVYVESWARDHNTRKHEMSQKGDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.26
4 0.24
5 0.19
6 0.13
7 0.1
8 0.07
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.07
22 0.09
23 0.12
24 0.12
25 0.17
26 0.23
27 0.26
28 0.31
29 0.4
30 0.5
31 0.58
32 0.68
33 0.7
34 0.75
35 0.76
36 0.81
37 0.8
38 0.8
39 0.74
40 0.72
41 0.73
42 0.7
43 0.69
44 0.59
45 0.52
46 0.47
47 0.44
48 0.45
49 0.42
50 0.37
51 0.35
52 0.35
53 0.35
54 0.32
55 0.31
56 0.24
57 0.2
58 0.17
59 0.14
60 0.13
61 0.12
62 0.11
63 0.1
64 0.1
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.12
98 0.13
99 0.16
100 0.17
101 0.18
102 0.17
103 0.19
104 0.19
105 0.17
106 0.18
107 0.15
108 0.15
109 0.14
110 0.13
111 0.12
112 0.11
113 0.08
114 0.06
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.07
136 0.08
137 0.09
138 0.13
139 0.2
140 0.27
141 0.35
142 0.38
143 0.4
144 0.49
145 0.56
146 0.6
147 0.56
148 0.54
149 0.47
150 0.5
151 0.47
152 0.37
153 0.3
154 0.27
155 0.24
156 0.2
157 0.18
158 0.12
159 0.12
160 0.12
161 0.11
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.05
172 0.06
173 0.07
174 0.06
175 0.07
176 0.07
177 0.09
178 0.09
179 0.1
180 0.1
181 0.09
182 0.09
183 0.08
184 0.08
185 0.07
186 0.06
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.07
205 0.1
206 0.1
207 0.09
208 0.11
209 0.1
210 0.11
211 0.12
212 0.16
213 0.17
214 0.25
215 0.29
216 0.29
217 0.32
218 0.35
219 0.38
220 0.39
221 0.44
222 0.45
223 0.48
224 0.54
225 0.55
226 0.61
227 0.66
228 0.68
229 0.67