Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G9Y8

Protein Details
Accession R1G9Y8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
216-241GEPETPTPKKRGRPSKKDKEAKAAAEBasic
NLS Segment(s)
PositionSequence
102-127RAPKTPKDPAATPGSATPKKRGRGKK
192-238TPKKPRARKAAAATPKKSTGAAEGGEPETPTPKKRGRPSKKDKEAKA
Subcellular Location(s) nucl 15cyto_nucl 15, cyto 11
Family & Domain DBs
KEGG npa:UCRNP2_8332  -  
Amino Acid Sequences MTADTTPVPTAEGSAPPSNGNDSARVASPTSLNDREINIITAMLRAMVQPPQVDFPKTAELLNMTNNASARNAINRILKRLDGPVNNAISPLPVEGQAKTPRAPKTPKDPAATPGSATPKKRGRGKKEDGENENADTNDAAAASSPVAASPGGDDDAADNVVEDAPMPKKQRKEPVKDEEVEGGADAAAPSTPKKPRARKAAAATPKKSTGAAEGGEPETPTPKKRGRPSKKDKEAKAAAEAEAAKVAGEVAEAKEEGDGKAGEAGAGAEKKEEEEEEEEEGEGVKEEASGAEADVESDGEPGIMVKTSIVGNPVDSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.25
5 0.25
6 0.26
7 0.25
8 0.22
9 0.22
10 0.23
11 0.24
12 0.24
13 0.22
14 0.2
15 0.21
16 0.22
17 0.27
18 0.27
19 0.27
20 0.27
21 0.28
22 0.3
23 0.29
24 0.27
25 0.2
26 0.18
27 0.15
28 0.14
29 0.12
30 0.09
31 0.08
32 0.07
33 0.09
34 0.11
35 0.12
36 0.13
37 0.14
38 0.2
39 0.22
40 0.23
41 0.23
42 0.23
43 0.27
44 0.26
45 0.25
46 0.21
47 0.21
48 0.2
49 0.22
50 0.21
51 0.17
52 0.18
53 0.18
54 0.17
55 0.15
56 0.15
57 0.14
58 0.16
59 0.17
60 0.2
61 0.28
62 0.29
63 0.33
64 0.33
65 0.33
66 0.3
67 0.34
68 0.36
69 0.31
70 0.34
71 0.35
72 0.35
73 0.34
74 0.33
75 0.27
76 0.2
77 0.18
78 0.14
79 0.08
80 0.08
81 0.1
82 0.1
83 0.16
84 0.21
85 0.23
86 0.25
87 0.3
88 0.32
89 0.38
90 0.44
91 0.43
92 0.48
93 0.56
94 0.61
95 0.59
96 0.56
97 0.54
98 0.54
99 0.49
100 0.4
101 0.34
102 0.35
103 0.35
104 0.35
105 0.38
106 0.38
107 0.44
108 0.53
109 0.58
110 0.6
111 0.66
112 0.73
113 0.73
114 0.76
115 0.78
116 0.72
117 0.69
118 0.6
119 0.51
120 0.44
121 0.35
122 0.26
123 0.18
124 0.14
125 0.08
126 0.06
127 0.05
128 0.03
129 0.04
130 0.03
131 0.04
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.04
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.04
152 0.06
153 0.1
154 0.14
155 0.17
156 0.22
157 0.28
158 0.38
159 0.46
160 0.53
161 0.59
162 0.64
163 0.67
164 0.63
165 0.59
166 0.51
167 0.42
168 0.33
169 0.23
170 0.14
171 0.08
172 0.07
173 0.05
174 0.03
175 0.03
176 0.03
177 0.05
178 0.1
179 0.14
180 0.22
181 0.31
182 0.4
183 0.48
184 0.59
185 0.65
186 0.68
187 0.71
188 0.73
189 0.74
190 0.73
191 0.68
192 0.61
193 0.56
194 0.49
195 0.42
196 0.33
197 0.26
198 0.2
199 0.18
200 0.15
201 0.15
202 0.15
203 0.15
204 0.15
205 0.12
206 0.14
207 0.15
208 0.16
209 0.21
210 0.27
211 0.35
212 0.45
213 0.56
214 0.62
215 0.72
216 0.81
217 0.86
218 0.9
219 0.91
220 0.86
221 0.84
222 0.8
223 0.71
224 0.66
225 0.56
226 0.46
227 0.4
228 0.36
229 0.26
230 0.2
231 0.17
232 0.11
233 0.09
234 0.08
235 0.04
236 0.04
237 0.05
238 0.05
239 0.07
240 0.07
241 0.07
242 0.08
243 0.09
244 0.09
245 0.1
246 0.1
247 0.09
248 0.1
249 0.1
250 0.09
251 0.08
252 0.09
253 0.1
254 0.11
255 0.1
256 0.1
257 0.1
258 0.11
259 0.12
260 0.12
261 0.13
262 0.15
263 0.17
264 0.19
265 0.19
266 0.18
267 0.17
268 0.17
269 0.13
270 0.1
271 0.09
272 0.06
273 0.05
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.07
280 0.07
281 0.08
282 0.08
283 0.08
284 0.07
285 0.07
286 0.07
287 0.05
288 0.05
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.08
295 0.09
296 0.1
297 0.12
298 0.11