Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S071

Protein Details
Accession F4S071    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-27NPSSIHSKKNHSNFQRNKLSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10, cyto 7, mito 5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR005078  Peptidase_C54  
IPR046792  Peptidase_C54_cat  
Gene Ontology GO:0005634  C:nucleus  
GO:0000407  C:phagophore assembly site  
GO:0019786  F:Atg8-specific peptidase activity  
GO:0006914  P:autophagy  
GO:0015031  P:protein transport  
GO:0006508  P:proteolysis  
KEGG mlr:MELLADRAFT_123246  -  
Pfam View protein in Pfam  
PF03416  Peptidase_C54  
Amino Acid Sequences MYPPESNPSSIHSKKNHSNFQRNKLSTSSSNDLYLISSNLTNHQIQTQIELDTLHEQLQFYLVPHHLSELKSDPTKSVRWRRPVLVLMNVQSGLDRVNINPSYCKTIEATFTFPQSVGIAGGRPSQSLFLWISI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.71
4 0.71
5 0.77
6 0.79
7 0.82
8 0.85
9 0.77
10 0.71
11 0.64
12 0.59
13 0.53
14 0.52
15 0.46
16 0.37
17 0.36
18 0.33
19 0.3
20 0.25
21 0.21
22 0.14
23 0.1
24 0.1
25 0.09
26 0.11
27 0.14
28 0.14
29 0.13
30 0.14
31 0.15
32 0.14
33 0.17
34 0.16
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.13
41 0.1
42 0.1
43 0.09
44 0.09
45 0.1
46 0.08
47 0.07
48 0.09
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.11
55 0.13
56 0.13
57 0.16
58 0.16
59 0.17
60 0.17
61 0.18
62 0.23
63 0.29
64 0.37
65 0.41
66 0.48
67 0.51
68 0.52
69 0.54
70 0.55
71 0.5
72 0.46
73 0.41
74 0.34
75 0.32
76 0.29
77 0.24
78 0.18
79 0.15
80 0.1
81 0.09
82 0.08
83 0.07
84 0.14
85 0.16
86 0.17
87 0.2
88 0.21
89 0.26
90 0.26
91 0.27
92 0.22
93 0.22
94 0.27
95 0.26
96 0.3
97 0.26
98 0.27
99 0.26
100 0.24
101 0.23
102 0.18
103 0.16
104 0.11
105 0.1
106 0.1
107 0.1
108 0.15
109 0.14
110 0.15
111 0.15
112 0.16
113 0.15
114 0.18