Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G0V9

Protein Details
Accession R1G0V9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
175-205GSIHPMARPKGDKKKQPKKVKSYGKGKKGASBasic
NLS Segment(s)
PositionSequence
181-208ARPKGDKKKQPKKVKSYGKGKKGASGKS
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 5
Family & Domain DBs
KEGG npa:UCRNP2_8267  -  
Amino Acid Sequences MAADVQSQSGKAEKPAHKLGRAQVPVPDISIHSQHSEMRDLKSRYFTPMDSPTSPSSKSEKTVAPGTPAIVTTRKTEETPEKDDSFVTVQEEPSSAKKGFEKHESLVAAAREAMATPAPAGKSNWADGSATPEEFSTPLENKSEMDKVAEKTDKVKVEDSAVTDPLEKSMPHDTGSIHPMARPKGDKKKQPKKVKSYGKGKKGASGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.49
3 0.54
4 0.55
5 0.59
6 0.6
7 0.61
8 0.59
9 0.53
10 0.46
11 0.43
12 0.39
13 0.35
14 0.29
15 0.2
16 0.2
17 0.22
18 0.19
19 0.18
20 0.19
21 0.2
22 0.22
23 0.26
24 0.26
25 0.27
26 0.35
27 0.35
28 0.37
29 0.41
30 0.4
31 0.39
32 0.39
33 0.35
34 0.33
35 0.37
36 0.39
37 0.34
38 0.37
39 0.35
40 0.35
41 0.36
42 0.32
43 0.31
44 0.28
45 0.29
46 0.29
47 0.28
48 0.29
49 0.33
50 0.31
51 0.29
52 0.27
53 0.25
54 0.22
55 0.2
56 0.18
57 0.15
58 0.16
59 0.15
60 0.18
61 0.19
62 0.18
63 0.22
64 0.29
65 0.32
66 0.36
67 0.39
68 0.36
69 0.35
70 0.35
71 0.32
72 0.24
73 0.19
74 0.16
75 0.12
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.14
82 0.13
83 0.13
84 0.15
85 0.19
86 0.22
87 0.26
88 0.28
89 0.25
90 0.28
91 0.27
92 0.25
93 0.24
94 0.2
95 0.15
96 0.11
97 0.1
98 0.07
99 0.06
100 0.06
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.07
107 0.07
108 0.1
109 0.11
110 0.13
111 0.13
112 0.12
113 0.12
114 0.11
115 0.18
116 0.16
117 0.15
118 0.14
119 0.13
120 0.13
121 0.12
122 0.14
123 0.11
124 0.11
125 0.12
126 0.14
127 0.14
128 0.14
129 0.17
130 0.18
131 0.15
132 0.17
133 0.19
134 0.19
135 0.25
136 0.27
137 0.25
138 0.26
139 0.32
140 0.33
141 0.32
142 0.33
143 0.27
144 0.28
145 0.3
146 0.3
147 0.26
148 0.23
149 0.21
150 0.21
151 0.2
152 0.17
153 0.17
154 0.13
155 0.14
156 0.18
157 0.19
158 0.19
159 0.2
160 0.2
161 0.23
162 0.26
163 0.25
164 0.2
165 0.21
166 0.25
167 0.26
168 0.31
169 0.34
170 0.4
171 0.49
172 0.58
173 0.66
174 0.72
175 0.81
176 0.85
177 0.9
178 0.91
179 0.9
180 0.92
181 0.93
182 0.92
183 0.92
184 0.92
185 0.91
186 0.88
187 0.79
188 0.77