Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1GGR3

Protein Details
Accession R1GGR3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
225-247DEFRARKREEERKKSERDIRKEEBasic
NLS Segment(s)
PositionSequence
228-259RARKREEERKKSERDIRKEEVLRARAAEREEK
Subcellular Location(s) cysk 13, cyto 6, nucl 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
KEGG npa:UCRNP2_8143  -  
Amino Acid Sequences MFALYLDIQKQLVLEDLDGDEAKGRWKSFVGKWNRGELAEGWYDPATLERAVAAAAENGAPAGEAEGRGRRRSSPDYGGAARRGAEEKADADGSEDEDDDDDDDEFGPAALPGDAVGFVAAASSSRKSGPAIPRLEDLDMRNELNADDAADRLAHMRALRKADRALQKERLEEMVPRADPGSRERQLEKRRETTDAMRAFRDAKAPGEMEEIGERDLMGGGDGVDEFRARKREEERKKSERDIRKEEVLRARAAEREEKFAEHRAKEEKTMEMLRALARQRFGGGGSGSGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.13
6 0.13
7 0.12
8 0.11
9 0.16
10 0.18
11 0.18
12 0.18
13 0.21
14 0.28
15 0.32
16 0.41
17 0.47
18 0.52
19 0.56
20 0.61
21 0.61
22 0.54
23 0.5
24 0.42
25 0.37
26 0.3
27 0.26
28 0.21
29 0.19
30 0.19
31 0.16
32 0.16
33 0.12
34 0.1
35 0.1
36 0.08
37 0.08
38 0.08
39 0.08
40 0.07
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.05
50 0.05
51 0.06
52 0.08
53 0.15
54 0.18
55 0.21
56 0.23
57 0.25
58 0.31
59 0.36
60 0.4
61 0.4
62 0.42
63 0.44
64 0.47
65 0.47
66 0.42
67 0.37
68 0.31
69 0.27
70 0.23
71 0.18
72 0.16
73 0.13
74 0.12
75 0.14
76 0.13
77 0.11
78 0.12
79 0.12
80 0.12
81 0.11
82 0.1
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.05
111 0.06
112 0.06
113 0.07
114 0.08
115 0.15
116 0.21
117 0.28
118 0.3
119 0.3
120 0.31
121 0.32
122 0.32
123 0.27
124 0.22
125 0.18
126 0.17
127 0.15
128 0.14
129 0.13
130 0.11
131 0.1
132 0.09
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.07
143 0.11
144 0.14
145 0.19
146 0.21
147 0.22
148 0.24
149 0.3
150 0.37
151 0.38
152 0.41
153 0.44
154 0.45
155 0.44
156 0.44
157 0.39
158 0.32
159 0.28
160 0.25
161 0.22
162 0.19
163 0.18
164 0.17
165 0.16
166 0.17
167 0.2
168 0.25
169 0.23
170 0.26
171 0.29
172 0.38
173 0.45
174 0.53
175 0.55
176 0.54
177 0.54
178 0.55
179 0.55
180 0.51
181 0.51
182 0.48
183 0.44
184 0.37
185 0.36
186 0.34
187 0.31
188 0.3
189 0.22
190 0.17
191 0.19
192 0.18
193 0.18
194 0.19
195 0.18
196 0.15
197 0.15
198 0.14
199 0.12
200 0.11
201 0.1
202 0.07
203 0.08
204 0.06
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.06
214 0.1
215 0.16
216 0.16
217 0.23
218 0.32
219 0.42
220 0.53
221 0.63
222 0.69
223 0.73
224 0.79
225 0.82
226 0.83
227 0.83
228 0.81
229 0.79
230 0.75
231 0.75
232 0.72
233 0.7
234 0.7
235 0.63
236 0.55
237 0.49
238 0.44
239 0.39
240 0.38
241 0.39
242 0.32
243 0.35
244 0.35
245 0.35
246 0.36
247 0.41
248 0.46
249 0.39
250 0.42
251 0.43
252 0.44
253 0.47
254 0.47
255 0.42
256 0.4
257 0.42
258 0.38
259 0.32
260 0.31
261 0.28
262 0.31
263 0.32
264 0.3
265 0.29
266 0.28
267 0.28
268 0.27
269 0.26
270 0.24
271 0.2
272 0.17