Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1G9S0

Protein Details
Accession R1G9S0    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
71-90RANNGKSKPHRDKKVKLSTVHydrophilic
109-134AGMSALKPRDRSKRKKDKKKKKTAAABasic
NLS Segment(s)
PositionSequence
115-134KPRDRSKRKKDKKKKKTAAA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG npa:UCRNP2_4951  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MADKHLSNEEFFARLTELFDSRRNKDHGTVYLTQKRLTFDLNSREGTPAAKVADDPLWDTHPPNPLPVLVRANNGKSKPHRDKKVKLSTVVQPDALEGFYARYADVCKAGMSALKPRDRSKRKKDKKKKKTAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.18
6 0.25
7 0.29
8 0.31
9 0.38
10 0.4
11 0.4
12 0.42
13 0.45
14 0.44
15 0.44
16 0.47
17 0.48
18 0.52
19 0.51
20 0.47
21 0.44
22 0.4
23 0.35
24 0.32
25 0.27
26 0.25
27 0.31
28 0.33
29 0.32
30 0.31
31 0.31
32 0.28
33 0.25
34 0.2
35 0.15
36 0.12
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.1
44 0.13
45 0.13
46 0.14
47 0.15
48 0.19
49 0.19
50 0.18
51 0.17
52 0.16
53 0.17
54 0.18
55 0.2
56 0.16
57 0.18
58 0.19
59 0.22
60 0.25
61 0.25
62 0.28
63 0.29
64 0.38
65 0.47
66 0.54
67 0.62
68 0.66
69 0.74
70 0.79
71 0.84
72 0.78
73 0.71
74 0.66
75 0.63
76 0.62
77 0.54
78 0.44
79 0.33
80 0.29
81 0.26
82 0.22
83 0.15
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.07
90 0.08
91 0.09
92 0.11
93 0.1
94 0.1
95 0.1
96 0.11
97 0.13
98 0.13
99 0.2
100 0.27
101 0.32
102 0.36
103 0.43
104 0.54
105 0.62
106 0.71
107 0.74
108 0.78
109 0.83
110 0.91
111 0.95
112 0.96
113 0.96
114 0.97