Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G5H9

Protein Details
Accession R1G5H9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-51EALKHRFRKFKKPVARNGTPRKAABasic
NLS Segment(s)
PositionSequence
31-71KHRFRKFKKPVARNGTPRKAAAPEAPKAAKTPKAAARKRKG
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
KEGG npa:UCRNP2_6562  -  
Amino Acid Sequences MEVCGMNISGPHLTFRPNSASPTGFTAEALKHRFRKFKKPVARNGTPRKAAAPEAPKAAKTPKAAARKRKGEDVTSGGDGHDGGEKTARSSPPKRAKVYAEPLPNDEEEPESAPKVKHEENAELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.25
4 0.24
5 0.27
6 0.29
7 0.29
8 0.27
9 0.3
10 0.29
11 0.22
12 0.21
13 0.2
14 0.18
15 0.23
16 0.26
17 0.28
18 0.34
19 0.39
20 0.48
21 0.5
22 0.59
23 0.62
24 0.68
25 0.73
26 0.74
27 0.8
28 0.8
29 0.84
30 0.83
31 0.83
32 0.81
33 0.73
34 0.64
35 0.56
36 0.49
37 0.42
38 0.38
39 0.32
40 0.26
41 0.28
42 0.28
43 0.26
44 0.26
45 0.27
46 0.25
47 0.22
48 0.25
49 0.29
50 0.38
51 0.44
52 0.52
53 0.59
54 0.62
55 0.63
56 0.65
57 0.6
58 0.52
59 0.5
60 0.44
61 0.38
62 0.3
63 0.28
64 0.2
65 0.18
66 0.16
67 0.12
68 0.12
69 0.09
70 0.08
71 0.1
72 0.1
73 0.12
74 0.17
75 0.2
76 0.24
77 0.28
78 0.39
79 0.47
80 0.55
81 0.57
82 0.58
83 0.61
84 0.63
85 0.67
86 0.64
87 0.61
88 0.55
89 0.53
90 0.51
91 0.46
92 0.37
93 0.3
94 0.24
95 0.18
96 0.19
97 0.19
98 0.18
99 0.2
100 0.2
101 0.22
102 0.27
103 0.29
104 0.31
105 0.34