Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G8D2

Protein Details
Accession R1G8D2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MASKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
101-133IEKASRQQRKQRKNRSKEFRGTAKTKGGKKDKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_5495  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSQVTLRTRKFIRNPLLGRKQMVVDVLHPNRANVSKEELREKLAQLYKASKDQVNCFGFRTQYGGGKSTGFALIYDSNEAMKKFEPHYRLVRVGMASKIEKASRQQRKQRKNRSKEFRGTAKTKGGKKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.3
26 0.36
27 0.33
28 0.34
29 0.34
30 0.33
31 0.33
32 0.32
33 0.31
34 0.28
35 0.32
36 0.3
37 0.31
38 0.33
39 0.27
40 0.26
41 0.27
42 0.33
43 0.31
44 0.29
45 0.27
46 0.27
47 0.25
48 0.23
49 0.23
50 0.15
51 0.17
52 0.17
53 0.17
54 0.16
55 0.16
56 0.16
57 0.13
58 0.13
59 0.09
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.1
71 0.12
72 0.14
73 0.2
74 0.22
75 0.26
76 0.32
77 0.35
78 0.36
79 0.35
80 0.34
81 0.3
82 0.3
83 0.26
84 0.24
85 0.2
86 0.19
87 0.21
88 0.2
89 0.21
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.79
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.75
110 0.74
111 0.72
112 0.68
113 0.7