Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1EMH6

Protein Details
Accession R1EMH6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
188-211GYQTCKEIRRWEKKNKYPHLPIIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 15, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0016301  F:kinase activity  
GO:0000160  P:phosphorelay signal transduction system  
GO:0016310  P:phosphorylation  
KEGG npa:UCRNP2_4257  -  
Pfam View protein in Pfam  
PF00072  Response_reg  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
CDD cd17546  REC_hyHK_CKI1_RcsC-like  
Amino Acid Sequences MIGGDDPVIFTHVVLVLHDSKDVIEFIDQVFHSQPHFATSVIIISDLVQKREVMAEAQSHDYDKLIEDRRLRFIFKPLKPSKFAVIFDPRKEREISTDRNENSAQQVAVNQKAVFDDMKHRLGNKGHRVLLVEDNKINQTVLLKLLGKTSINVETVLDGVECTDKVFSMDHGYYSIILCDLHMPNKDGYQTCKEIRRWEKKNKYPHLPIIALSANVLGDVYSKCVEAGFNSYVTKPVDFKELSAVMTRFLDPKDPSKPHEFMRPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.16
4 0.17
5 0.17
6 0.16
7 0.14
8 0.15
9 0.15
10 0.11
11 0.09
12 0.09
13 0.09
14 0.15
15 0.14
16 0.15
17 0.17
18 0.16
19 0.16
20 0.17
21 0.17
22 0.15
23 0.16
24 0.14
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.09
31 0.09
32 0.17
33 0.18
34 0.19
35 0.18
36 0.18
37 0.18
38 0.2
39 0.2
40 0.13
41 0.13
42 0.15
43 0.16
44 0.19
45 0.19
46 0.18
47 0.18
48 0.17
49 0.15
50 0.13
51 0.18
52 0.19
53 0.24
54 0.28
55 0.31
56 0.38
57 0.4
58 0.41
59 0.36
60 0.41
61 0.47
62 0.45
63 0.53
64 0.53
65 0.57
66 0.57
67 0.58
68 0.55
69 0.5
70 0.47
71 0.43
72 0.45
73 0.45
74 0.46
75 0.52
76 0.47
77 0.44
78 0.44
79 0.38
80 0.36
81 0.38
82 0.39
83 0.37
84 0.44
85 0.42
86 0.44
87 0.43
88 0.36
89 0.32
90 0.27
91 0.21
92 0.14
93 0.16
94 0.15
95 0.17
96 0.17
97 0.15
98 0.13
99 0.13
100 0.14
101 0.11
102 0.1
103 0.15
104 0.17
105 0.21
106 0.21
107 0.21
108 0.24
109 0.29
110 0.36
111 0.37
112 0.39
113 0.36
114 0.36
115 0.37
116 0.35
117 0.38
118 0.33
119 0.27
120 0.22
121 0.22
122 0.21
123 0.2
124 0.17
125 0.1
126 0.08
127 0.07
128 0.07
129 0.09
130 0.09
131 0.09
132 0.1
133 0.11
134 0.1
135 0.1
136 0.11
137 0.12
138 0.11
139 0.11
140 0.11
141 0.1
142 0.1
143 0.09
144 0.07
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.05
153 0.06
154 0.06
155 0.1
156 0.11
157 0.11
158 0.11
159 0.12
160 0.12
161 0.11
162 0.11
163 0.06
164 0.06
165 0.06
166 0.09
167 0.1
168 0.13
169 0.14
170 0.16
171 0.16
172 0.18
173 0.22
174 0.2
175 0.23
176 0.26
177 0.29
178 0.32
179 0.38
180 0.4
181 0.46
182 0.55
183 0.61
184 0.64
185 0.7
186 0.77
187 0.78
188 0.86
189 0.85
190 0.85
191 0.82
192 0.8
193 0.76
194 0.67
195 0.59
196 0.53
197 0.45
198 0.35
199 0.27
200 0.2
201 0.12
202 0.11
203 0.1
204 0.05
205 0.06
206 0.06
207 0.09
208 0.09
209 0.09
210 0.09
211 0.1
212 0.1
213 0.1
214 0.15
215 0.14
216 0.16
217 0.17
218 0.17
219 0.21
220 0.22
221 0.22
222 0.18
223 0.18
224 0.24
225 0.23
226 0.23
227 0.26
228 0.26
229 0.26
230 0.3
231 0.29
232 0.23
233 0.25
234 0.25
235 0.21
236 0.21
237 0.26
238 0.24
239 0.31
240 0.39
241 0.41
242 0.46
243 0.51
244 0.54
245 0.51
246 0.59
247 0.62