Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1GQG8

Protein Details
Accession R1GQG8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-71CRKCYARLPPRATNCRKKKCGHTNQLRPKKKLKHydrophilic
NLS Segment(s)
PositionSequence
65-71RPKKKLK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG npa:UCRNP2_2749  -  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MSLNGMESTLHLVLRLRGGIIEPSLKALASKYNCDKMICRKCYARLPPRATNCRKKKCGHTNQLRPKKKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.1
4 0.09
5 0.1
6 0.11
7 0.11
8 0.12
9 0.1
10 0.11
11 0.11
12 0.11
13 0.1
14 0.1
15 0.15
16 0.15
17 0.2
18 0.21
19 0.26
20 0.27
21 0.28
22 0.3
23 0.34
24 0.42
25 0.41
26 0.41
27 0.39
28 0.42
29 0.5
30 0.58
31 0.56
32 0.57
33 0.61
34 0.66
35 0.72
36 0.78
37 0.78
38 0.79
39 0.81
40 0.81
41 0.81
42 0.8
43 0.82
44 0.83
45 0.85
46 0.85
47 0.86
48 0.86
49 0.9
50 0.95
51 0.93