Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1G379

Protein Details
Accession R1G379    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-179TFLIRNYRDKDKNKKSDTHVRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, nucl 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006974  P:DNA damage response  
KEGG npa:UCRNP2_7390  -  
Pfam View protein in Pfam  
PF00867  XPG_I  
CDD cd09870  PIN_YEN1  
Amino Acid Sequences MGIAGIWDVLGNGEITSIAQLASDHFRRTGRPLRIAVDEAGWRFCNLNPHQVRVIREKEPAANPVEKAIIFRILKLLKLNIRLLFIFDGPSRPWKKGKTAGMIKFKDIALLRRVLDLLRVPHHRAPAEAEAECASLQQEGIVDAVWSEDSDSLMFGCTFLIRNYRDKDKNKKSDTHVRVHRARDILEQKKLDRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.08
9 0.14
10 0.17
11 0.18
12 0.2
13 0.22
14 0.24
15 0.32
16 0.39
17 0.4
18 0.44
19 0.46
20 0.47
21 0.49
22 0.49
23 0.42
24 0.35
25 0.31
26 0.25
27 0.25
28 0.22
29 0.19
30 0.17
31 0.18
32 0.24
33 0.23
34 0.32
35 0.32
36 0.35
37 0.4
38 0.42
39 0.45
40 0.43
41 0.46
42 0.38
43 0.4
44 0.38
45 0.38
46 0.36
47 0.35
48 0.32
49 0.29
50 0.26
51 0.24
52 0.24
53 0.18
54 0.17
55 0.15
56 0.18
57 0.16
58 0.16
59 0.2
60 0.19
61 0.2
62 0.21
63 0.23
64 0.2
65 0.23
66 0.26
67 0.22
68 0.23
69 0.22
70 0.21
71 0.19
72 0.16
73 0.14
74 0.11
75 0.11
76 0.11
77 0.19
78 0.19
79 0.21
80 0.25
81 0.26
82 0.31
83 0.37
84 0.41
85 0.42
86 0.49
87 0.54
88 0.59
89 0.58
90 0.53
91 0.47
92 0.42
93 0.37
94 0.29
95 0.24
96 0.17
97 0.19
98 0.19
99 0.17
100 0.18
101 0.14
102 0.15
103 0.14
104 0.14
105 0.17
106 0.2
107 0.23
108 0.25
109 0.29
110 0.27
111 0.26
112 0.28
113 0.26
114 0.26
115 0.22
116 0.21
117 0.18
118 0.18
119 0.18
120 0.13
121 0.09
122 0.06
123 0.06
124 0.05
125 0.05
126 0.04
127 0.05
128 0.05
129 0.04
130 0.04
131 0.05
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.07
146 0.09
147 0.15
148 0.17
149 0.24
150 0.3
151 0.39
152 0.48
153 0.56
154 0.66
155 0.7
156 0.78
157 0.78
158 0.81
159 0.79
160 0.81
161 0.79
162 0.78
163 0.77
164 0.76
165 0.76
166 0.73
167 0.71
168 0.63
169 0.59
170 0.58
171 0.59
172 0.58
173 0.59
174 0.59
175 0.54