Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1G9J3

Protein Details
Accession R1G9J3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
304-326AGGRRQAKKRPGARKAGRKDGEKBasic
NLS Segment(s)
PositionSequence
244-326EKLSRAQKKRLKRQEEAARKKAMKEAEEEREEEEKRRRKAASAAREGGGAVRQMASVQKVAGGRRQAKKRPGARKAGRKDGEK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
KEGG npa:UCRNP2_8431  -  
Amino Acid Sequences MEECCSEQEWYEPWDGPEPLEEGSPPLCEPEDAAFIDPGSETGADVEREREQEQEPELELEPELEQPERSPSPSPERDPEPEPEPSPNPSPSASPSPDDSPDPSPQLDPPPPKNKTPLHPPPAQPRTPLPAQSSYSLRGSSLSGAVHAMPRRADFQAADESSSSSSDAHAPRLLGAGKKVWSEAEIDRLADVLVGRGDEEARRRRERVGERKLEVLRGVYGQVVRENAERERGVAEGGAEMEREKLSRAQKKRLKRQEEAARKKAMKEAEEEREEEEKRRRKAASAAREGGGAVRQMASVQKVAGGRRQAKKRPGARKAGRKDGEKGPDGVVVTTTTTEEIEETEKDDRSRGSVALMAAAMQNPSEDGDGDTEDDEDTQVDIYKLLQLRSRALFGRPEDEDATETGEPSRPALRRTASMEAVRDVEQDNEVLSDDDKATVEEVRDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.26
4 0.25
5 0.23
6 0.2
7 0.19
8 0.17
9 0.14
10 0.15
11 0.16
12 0.13
13 0.14
14 0.14
15 0.13
16 0.15
17 0.15
18 0.18
19 0.18
20 0.19
21 0.17
22 0.17
23 0.17
24 0.15
25 0.12
26 0.1
27 0.09
28 0.07
29 0.09
30 0.11
31 0.12
32 0.13
33 0.16
34 0.17
35 0.2
36 0.21
37 0.22
38 0.22
39 0.25
40 0.27
41 0.27
42 0.25
43 0.25
44 0.25
45 0.22
46 0.2
47 0.17
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.12
54 0.18
55 0.19
56 0.2
57 0.23
58 0.27
59 0.36
60 0.43
61 0.47
62 0.46
63 0.5
64 0.53
65 0.52
66 0.51
67 0.46
68 0.43
69 0.4
70 0.4
71 0.37
72 0.37
73 0.38
74 0.35
75 0.33
76 0.29
77 0.29
78 0.29
79 0.34
80 0.31
81 0.29
82 0.31
83 0.32
84 0.33
85 0.33
86 0.32
87 0.28
88 0.3
89 0.3
90 0.28
91 0.25
92 0.26
93 0.3
94 0.34
95 0.37
96 0.42
97 0.5
98 0.52
99 0.54
100 0.6
101 0.59
102 0.58
103 0.62
104 0.63
105 0.6
106 0.64
107 0.67
108 0.69
109 0.71
110 0.67
111 0.59
112 0.52
113 0.51
114 0.48
115 0.46
116 0.4
117 0.37
118 0.38
119 0.38
120 0.37
121 0.33
122 0.31
123 0.27
124 0.23
125 0.18
126 0.17
127 0.15
128 0.14
129 0.11
130 0.1
131 0.1
132 0.1
133 0.13
134 0.14
135 0.14
136 0.13
137 0.14
138 0.17
139 0.17
140 0.18
141 0.14
142 0.16
143 0.21
144 0.21
145 0.2
146 0.18
147 0.18
148 0.17
149 0.17
150 0.15
151 0.07
152 0.08
153 0.13
154 0.13
155 0.15
156 0.15
157 0.15
158 0.15
159 0.17
160 0.17
161 0.13
162 0.13
163 0.14
164 0.14
165 0.15
166 0.15
167 0.13
168 0.12
169 0.14
170 0.14
171 0.16
172 0.15
173 0.15
174 0.14
175 0.14
176 0.13
177 0.1
178 0.1
179 0.05
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.07
186 0.13
187 0.2
188 0.26
189 0.3
190 0.31
191 0.34
192 0.42
193 0.5
194 0.55
195 0.58
196 0.58
197 0.57
198 0.62
199 0.59
200 0.52
201 0.42
202 0.32
203 0.22
204 0.16
205 0.15
206 0.09
207 0.09
208 0.08
209 0.09
210 0.09
211 0.09
212 0.1
213 0.11
214 0.11
215 0.14
216 0.13
217 0.13
218 0.13
219 0.12
220 0.11
221 0.09
222 0.09
223 0.05
224 0.06
225 0.05
226 0.05
227 0.05
228 0.06
229 0.06
230 0.06
231 0.06
232 0.11
233 0.19
234 0.28
235 0.34
236 0.43
237 0.5
238 0.6
239 0.7
240 0.75
241 0.75
242 0.7
243 0.75
244 0.75
245 0.8
246 0.79
247 0.74
248 0.72
249 0.65
250 0.62
251 0.56
252 0.49
253 0.39
254 0.35
255 0.35
256 0.34
257 0.35
258 0.35
259 0.33
260 0.34
261 0.33
262 0.34
263 0.37
264 0.38
265 0.38
266 0.43
267 0.41
268 0.39
269 0.48
270 0.52
271 0.53
272 0.53
273 0.53
274 0.48
275 0.47
276 0.44
277 0.36
278 0.28
279 0.18
280 0.1
281 0.07
282 0.07
283 0.07
284 0.09
285 0.09
286 0.09
287 0.08
288 0.11
289 0.13
290 0.15
291 0.18
292 0.25
293 0.32
294 0.39
295 0.48
296 0.53
297 0.59
298 0.68
299 0.73
300 0.76
301 0.77
302 0.79
303 0.8
304 0.83
305 0.82
306 0.84
307 0.8
308 0.73
309 0.71
310 0.68
311 0.65
312 0.57
313 0.51
314 0.41
315 0.38
316 0.34
317 0.28
318 0.2
319 0.14
320 0.12
321 0.11
322 0.1
323 0.08
324 0.08
325 0.08
326 0.07
327 0.08
328 0.09
329 0.09
330 0.11
331 0.14
332 0.16
333 0.16
334 0.18
335 0.17
336 0.18
337 0.19
338 0.17
339 0.15
340 0.16
341 0.16
342 0.15
343 0.15
344 0.12
345 0.11
346 0.11
347 0.1
348 0.07
349 0.07
350 0.06
351 0.07
352 0.07
353 0.07
354 0.07
355 0.09
356 0.09
357 0.1
358 0.1
359 0.1
360 0.1
361 0.09
362 0.08
363 0.07
364 0.07
365 0.07
366 0.08
367 0.07
368 0.07
369 0.08
370 0.13
371 0.15
372 0.17
373 0.2
374 0.21
375 0.27
376 0.29
377 0.33
378 0.29
379 0.3
380 0.35
381 0.34
382 0.37
383 0.34
384 0.35
385 0.33
386 0.32
387 0.31
388 0.24
389 0.27
390 0.21
391 0.19
392 0.17
393 0.19
394 0.17
395 0.18
396 0.25
397 0.23
398 0.25
399 0.32
400 0.34
401 0.36
402 0.41
403 0.46
404 0.44
405 0.46
406 0.46
407 0.42
408 0.41
409 0.36
410 0.32
411 0.26
412 0.22
413 0.19
414 0.16
415 0.14
416 0.12
417 0.12
418 0.12
419 0.11
420 0.12
421 0.11
422 0.13
423 0.12
424 0.12
425 0.13
426 0.14