Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59PR9

Protein Details
Accession Q59PR9   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-92KIEATESKKKRKQEKDPNAPKKPLTBasic
193-223TDIVSSPEEPKKKKKKTEKKEKKKKSGHGSPBasic
NLS Segment(s)
PositionSequence
75-89KKKRKQEKDPNAPKK
202-223PKKKKKKTEKKEKKKKSGHGSP
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 8.5, cyto_mito 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005730  C:nucleolus  
GO:0033553  C:rDNA heterochromatin  
GO:0032040  C:small-subunit processome  
GO:0008301  F:DNA binding, bending  
GO:0003690  F:double-stranded DNA binding  
GO:0000400  F:four-way junction DNA binding  
GO:0043565  F:sequence-specific DNA binding  
GO:0044804  P:autophagy of nucleus  
GO:0006338  P:chromatin remodeling  
GO:0006265  P:DNA topological change  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:2000134  P:negative regulation of G1/S transition of mitotic cell cycle  
GO:2001034  P:positive regulation of double-strand break repair via nonhomologous end joining  
GO:0070550  P:rDNA chromatin condensation  
GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
GO:0006356  P:regulation of transcription by RNA polymerase I  
GO:0001174  P:transcriptional start site selection at RNA polymerase II promoter  
KEGG cal:CAALFM_CR05670CA  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MSDLKTTKDTLVSTLFELSKAAQDAANAAIEFYKVASGGSDHVSAEQLKAVSEALNTVATLSSGNGAKIEATESKKKRKQEKDPNAPKKPLTMFFQFSYDLRKKIGIERKKKDLPSLSAIDMNSMIKDRWDSISEAEKAGYKKRYDDAMIIYNIEKKKYEESLKDGSAYYPPPSVQTPIVGHGIEQDFDDDATDIVSSPEEPKKKKKKTEKKEKKKKSGHGSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.2
4 0.2
5 0.18
6 0.17
7 0.17
8 0.17
9 0.13
10 0.13
11 0.14
12 0.14
13 0.16
14 0.12
15 0.1
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.05
22 0.05
23 0.06
24 0.06
25 0.08
26 0.1
27 0.11
28 0.1
29 0.11
30 0.13
31 0.13
32 0.12
33 0.12
34 0.1
35 0.09
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.07
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.12
58 0.16
59 0.26
60 0.31
61 0.41
62 0.47
63 0.54
64 0.63
65 0.68
66 0.75
67 0.77
68 0.83
69 0.84
70 0.9
71 0.93
72 0.9
73 0.83
74 0.72
75 0.66
76 0.58
77 0.5
78 0.44
79 0.38
80 0.34
81 0.31
82 0.32
83 0.28
84 0.24
85 0.28
86 0.26
87 0.22
88 0.2
89 0.21
90 0.2
91 0.27
92 0.36
93 0.37
94 0.45
95 0.49
96 0.56
97 0.61
98 0.6
99 0.58
100 0.53
101 0.48
102 0.43
103 0.4
104 0.33
105 0.3
106 0.29
107 0.24
108 0.2
109 0.16
110 0.11
111 0.09
112 0.08
113 0.06
114 0.07
115 0.08
116 0.09
117 0.1
118 0.11
119 0.13
120 0.19
121 0.19
122 0.19
123 0.18
124 0.2
125 0.2
126 0.24
127 0.27
128 0.22
129 0.24
130 0.26
131 0.29
132 0.27
133 0.28
134 0.27
135 0.26
136 0.26
137 0.24
138 0.22
139 0.25
140 0.24
141 0.23
142 0.2
143 0.17
144 0.21
145 0.26
146 0.32
147 0.3
148 0.36
149 0.4
150 0.4
151 0.39
152 0.36
153 0.3
154 0.27
155 0.25
156 0.2
157 0.16
158 0.15
159 0.17
160 0.18
161 0.2
162 0.18
163 0.2
164 0.2
165 0.21
166 0.23
167 0.2
168 0.19
169 0.21
170 0.21
171 0.17
172 0.16
173 0.14
174 0.12
175 0.12
176 0.13
177 0.08
178 0.07
179 0.07
180 0.07
181 0.06
182 0.06
183 0.06
184 0.07
185 0.11
186 0.19
187 0.26
188 0.32
189 0.42
190 0.53
191 0.63
192 0.73
193 0.8
194 0.84
195 0.88
196 0.94
197 0.95
198 0.95
199 0.97
200 0.97
201 0.97
202 0.96
203 0.95