Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1GFL5

Protein Details
Accession R1GFL5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11, mito 7.5, mito_nucl 7.5, nucl 6.5, cyto_pero 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG npa:UCRNP2_6212  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVVLDKTTNDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKLQVYSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.81
11 0.72
12 0.65
13 0.54
14 0.49
15 0.4
16 0.35
17 0.28
18 0.21
19 0.22
20 0.2
21 0.23
22 0.2
23 0.2
24 0.2
25 0.27
26 0.3
27 0.31
28 0.32
29 0.32
30 0.34
31 0.34
32 0.32
33 0.26
34 0.22
35 0.17
36 0.15
37 0.12
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.1
45 0.1
46 0.11
47 0.13
48 0.16
49 0.17
50 0.17
51 0.18
52 0.17
53 0.17
54 0.18
55 0.16
56 0.16
57 0.14
58 0.16
59 0.21
60 0.22
61 0.22
62 0.24
63 0.24
64 0.22
65 0.27
66 0.33
67 0.37
68 0.39
69 0.44
70 0.45
71 0.51