FuNGI

R1G844

Protein Details

Accession

R1G844

Localization Confidence

Medium

Confidence Score

14.9

NoLS Segment(s)

Position	Sequence	Protein Nature
367-394	DILRWRCDQKYGRKPKRRPQSTLSINPN	Hydrophilic

NLS Segment(s)

Position	Sequence
382-382	K

Subcellular Location(s)

nucl 18, mito 6, cyto 2

Family & Domain DBs

InterPro	View protein in InterPro IPR009203 Knr4/Smi1 IPR018958 Knr4/Smi1-like_dom IPR037883 Knr4/Smi1-like_sf
Gene Ontology	GO:0042546 P:cell wall biogenesis
KEGG	npa:UCRNP2_5555 -
Pfam	View protein in Pfam PF09346 SMI1_KNR4

Amino Acid Sequences

MTPQPNMLTSAWRDFWHTMTSNDRHASHDSPYRTGQHVPLPQSRHTPLTSVATSAMESRTDFNSPYAQDEPNGFVSSPRAPMSPSSPYSPGMRSSVARPPDENPSIDAVNSGEIQMQSFSDGLPPPPPVGHSWKRIDRWLEDRFVELWDNMCEGATHNDVNELEHILDVTLPVEVRESLQIHDGQERGGLPTGLFFGCMILDCEEIVQEYTNWRRVNEEFLAAQPSYQPPQVPIKAVAGPSSSPTPTDAQKAANPMWRQDLLSRQDSQPPNAIQKAYAHPAWIPLARDWGGNCLAVDLAPGPAGKWGQVIIFGRDYDTKYVVARSWAAFLAQYTDDLCSDKCFIDEETNEMKLKLFAKQNVEPPYLDILRWRCDQKYGRKPKRRPQSTLSINPNAPPAANGTSPLSKNGASPRVPISSPLARVAEEAPAPIKVHTDEEKLIEMNTPRPSSDLNSSNATQKNSMESDKENGSEKGKGKSVVSSEEMKTVEI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.33
2	0.34
3	0.35
4	0.33
5	0.3
6	0.37
7	0.4
8	0.42
9	0.45
10	0.44
11	0.41
12	0.43
13	0.42
14	0.4
15	0.44
16	0.41
17	0.4
18	0.44
19	0.44
20	0.42
21	0.43
22	0.41
23	0.41
24	0.45
25	0.47
26	0.49
27	0.5
28	0.5
29	0.54
30	0.53
31	0.49
32	0.43
33	0.39
34	0.36
35	0.38
36	0.35
37	0.29
38	0.26
39	0.22
40	0.22
41	0.22
42	0.19
43	0.14
44	0.14
45	0.15
46	0.17
47	0.18
48	0.18
49	0.18
50	0.22
51	0.22
52	0.26
53	0.27
54	0.25
55	0.25
56	0.26
57	0.27
58	0.25
59	0.25
60	0.2
61	0.18
62	0.21
63	0.22
64	0.23
65	0.21
66	0.18
67	0.18
68	0.2
69	0.25
70	0.29
71	0.29
72	0.3
73	0.31
74	0.32
75	0.34
76	0.34
77	0.32
78	0.27
79	0.27
80	0.24
81	0.26
82	0.32
83	0.34
84	0.34
85	0.33
86	0.32
87	0.39
88	0.4
89	0.36
90	0.31
91	0.29
92	0.28
93	0.25
94	0.24
95	0.15
96	0.14
97	0.13
98	0.11
99	0.1
100	0.09
101	0.1
102	0.1
103	0.09
104	0.09
105	0.08
106	0.08
107	0.09
108	0.1
109	0.11
110	0.13
111	0.14
112	0.14
113	0.14
114	0.15
115	0.16
116	0.24
117	0.29
118	0.35
119	0.41
120	0.48
121	0.5
122	0.54
123	0.55
124	0.51
125	0.52
126	0.49
127	0.46
128	0.39
129	0.39
130	0.34
131	0.31
132	0.27
133	0.2
134	0.17
135	0.13
136	0.13
137	0.11
138	0.1
139	0.09
140	0.08
141	0.11
142	0.12
143	0.11
144	0.1
145	0.13
146	0.13
147	0.13
148	0.13
149	0.11
150	0.09
151	0.09
152	0.09
153	0.06
154	0.06
155	0.05
156	0.05
157	0.04
158	0.04
159	0.04
160	0.05
161	0.05
162	0.06
163	0.09
164	0.1
165	0.1
166	0.12
167	0.14
168	0.14
169	0.17
170	0.16
171	0.13
172	0.13
173	0.13
174	0.12
175	0.11
176	0.1
177	0.07
178	0.08
179	0.09
180	0.08
181	0.07
182	0.06
183	0.05
184	0.05
185	0.06
186	0.06
187	0.06
188	0.06
189	0.06
190	0.06
191	0.06
192	0.06
193	0.06
194	0.05
195	0.04
196	0.08
197	0.11
198	0.17
199	0.18
200	0.18
201	0.21
202	0.21
203	0.26
204	0.24
205	0.23
206	0.17
207	0.18
208	0.2
209	0.17
210	0.16
211	0.12
212	0.12
213	0.12
214	0.12
215	0.12
216	0.11
217	0.18
218	0.19
219	0.19
220	0.19
221	0.2
222	0.21
223	0.21
224	0.19
225	0.14
226	0.13
227	0.13
228	0.13
229	0.11
230	0.09
231	0.11
232	0.12
233	0.12
234	0.15
235	0.15
236	0.15
237	0.16
238	0.19
239	0.19
240	0.23
241	0.22
242	0.21
243	0.23
244	0.22
245	0.21
246	0.19
247	0.25
248	0.23
249	0.26
250	0.27
251	0.25
252	0.32
253	0.33
254	0.32
255	0.31
256	0.28
257	0.29
258	0.29
259	0.28
260	0.21
261	0.23
262	0.24
263	0.22
264	0.21
265	0.17
266	0.15
267	0.17
268	0.18
269	0.17
270	0.15
271	0.12
272	0.15
273	0.15
274	0.16
275	0.14
276	0.15
277	0.15
278	0.13
279	0.13
280	0.09
281	0.09
282	0.08
283	0.08
284	0.05
285	0.04
286	0.05
287	0.05
288	0.04
289	0.06
290	0.06
291	0.06
292	0.06
293	0.07
294	0.06
295	0.1
296	0.11
297	0.12
298	0.13
299	0.13
300	0.14
301	0.16
302	0.17
303	0.15
304	0.16
305	0.14
306	0.14
307	0.15
308	0.15
309	0.14
310	0.15
311	0.14
312	0.14
313	0.13
314	0.13
315	0.11
316	0.11
317	0.12
318	0.1
319	0.1
320	0.09
321	0.09
322	0.1
323	0.11
324	0.11
325	0.09
326	0.11
327	0.11
328	0.11
329	0.11
330	0.12
331	0.16
332	0.16
333	0.2
334	0.22
335	0.24
336	0.24
337	0.23
338	0.22
339	0.2
340	0.21
341	0.21
342	0.24
343	0.26
344	0.33
345	0.37
346	0.44
347	0.46
348	0.47
349	0.41
350	0.38
351	0.39
352	0.33
353	0.28
354	0.27
355	0.25
356	0.27
357	0.31
358	0.32
359	0.27
360	0.35
361	0.43
362	0.49
363	0.56
364	0.63
365	0.7
366	0.78
367	0.87
368	0.88
369	0.92
370	0.9
371	0.86
372	0.82
373	0.81
374	0.8
375	0.8
376	0.78
377	0.74
378	0.65
379	0.59
380	0.55
381	0.44
382	0.34
383	0.25
384	0.21
385	0.18
386	0.17
387	0.18
388	0.19
389	0.24
390	0.24
391	0.26
392	0.24
393	0.21
394	0.25
395	0.3
396	0.34
397	0.3
398	0.32
399	0.34
400	0.36
401	0.35
402	0.34
403	0.33
404	0.32
405	0.33
406	0.34
407	0.31
408	0.27
409	0.29
410	0.27
411	0.25
412	0.19
413	0.18
414	0.15
415	0.16
416	0.17
417	0.15
418	0.17
419	0.14
420	0.19
421	0.22
422	0.25
423	0.25
424	0.27
425	0.29
426	0.27
427	0.26
428	0.25
429	0.24
430	0.25
431	0.3
432	0.29
433	0.27
434	0.28
435	0.3
436	0.3
437	0.36
438	0.35
439	0.32
440	0.36
441	0.37
442	0.43
443	0.45
444	0.43
445	0.38
446	0.34
447	0.36
448	0.35
449	0.37
450	0.34
451	0.32
452	0.34
453	0.35
454	0.36
455	0.34
456	0.33
457	0.33
458	0.36
459	0.37
460	0.38
461	0.4
462	0.4
463	0.38
464	0.41
465	0.42
466	0.4
467	0.4
468	0.4
469	0.37
470	0.39

R1G844

3D AlphaFold-predicted Structure Viewer