Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EIJ3

Protein Details
Accession R1EIJ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39DPCTTNSKNKVPKRPACSPSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, E.R. 2
Family & Domain DBs
KEGG npa:UCRNP2_5913  -  
Amino Acid Sequences MRFTLATVLATAVAVSATLDPCTTNSKNKVPKRPACSPSESSDDIQAAECSHNTRLSDTQTFAVWTRTKTNSNGISYGTCEAYSCTAPTKKEMTAQEGGWTFFWNSNGVSEGFGTGCIQDPNTGECGCENSNGDFIVGSDSCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.09
9 0.16
10 0.19
11 0.25
12 0.3
13 0.39
14 0.49
15 0.57
16 0.67
17 0.7
18 0.76
19 0.76
20 0.8
21 0.77
22 0.73
23 0.71
24 0.64
25 0.58
26 0.55
27 0.49
28 0.4
29 0.37
30 0.31
31 0.24
32 0.21
33 0.17
34 0.12
35 0.11
36 0.1
37 0.1
38 0.11
39 0.13
40 0.13
41 0.15
42 0.16
43 0.19
44 0.21
45 0.2
46 0.19
47 0.17
48 0.18
49 0.16
50 0.19
51 0.16
52 0.15
53 0.19
54 0.21
55 0.23
56 0.24
57 0.29
58 0.29
59 0.29
60 0.29
61 0.25
62 0.22
63 0.21
64 0.21
65 0.15
66 0.1
67 0.09
68 0.08
69 0.09
70 0.09
71 0.08
72 0.11
73 0.14
74 0.15
75 0.18
76 0.2
77 0.2
78 0.25
79 0.27
80 0.28
81 0.29
82 0.28
83 0.29
84 0.27
85 0.27
86 0.21
87 0.21
88 0.16
89 0.15
90 0.15
91 0.12
92 0.11
93 0.11
94 0.13
95 0.12
96 0.12
97 0.1
98 0.1
99 0.09
100 0.09
101 0.08
102 0.07
103 0.08
104 0.08
105 0.09
106 0.1
107 0.12
108 0.13
109 0.16
110 0.16
111 0.15
112 0.15
113 0.19
114 0.18
115 0.19
116 0.19
117 0.18
118 0.2
119 0.19
120 0.19
121 0.14
122 0.13
123 0.16