Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R1EEC4

Protein Details
Accession R1EEC4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-74WMLKNEKEKKRQPQADQKKTYHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.333
Family & Domain DBs
Gene Ontology GO:0016740  F:transferase activity  
KEGG npa:UCRNP2_7172  -  
Amino Acid Sequences MQPPRPNPYSGKIYTIQRVNGNGANGKTDGNPGPHKHDLDESDKIKKNSVVRWMLKNEKEKKRQPQADQKKTYHTKATGKALETVKKHAAENELKLFGSCFWWPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.46
4 0.41
5 0.41
6 0.4
7 0.37
8 0.34
9 0.31
10 0.27
11 0.25
12 0.22
13 0.21
14 0.17
15 0.18
16 0.18
17 0.19
18 0.24
19 0.24
20 0.31
21 0.34
22 0.34
23 0.32
24 0.33
25 0.32
26 0.33
27 0.37
28 0.32
29 0.36
30 0.4
31 0.39
32 0.37
33 0.37
34 0.35
35 0.32
36 0.38
37 0.38
38 0.37
39 0.41
40 0.44
41 0.47
42 0.49
43 0.54
44 0.55
45 0.57
46 0.63
47 0.66
48 0.71
49 0.76
50 0.78
51 0.77
52 0.79
53 0.81
54 0.83
55 0.83
56 0.75
57 0.75
58 0.72
59 0.68
60 0.63
61 0.58
62 0.54
63 0.53
64 0.59
65 0.53
66 0.49
67 0.52
68 0.5
69 0.5
70 0.45
71 0.44
72 0.41
73 0.39
74 0.39
75 0.35
76 0.38
77 0.37
78 0.41
79 0.41
80 0.37
81 0.36
82 0.35
83 0.33
84 0.26
85 0.24