Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R1GEJ8

Protein Details
Accession R1GEJ8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-67QSQLSSSSKRKIKKRRTARDKTYKPTVEHydrophilic
102-124EEPEEKKKGKRKVKAKGIEKTVTBasic
NLS Segment(s)
PositionSequence
48-58KRKIKKRRTAR
107-118KKKGKRKVKAKG
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 6
Family & Domain DBs
KEGG npa:UCRNP2_6580  -  
Amino Acid Sequences MESEDERLAREASVVPAEQSRAEGESGVLEEIVDESEVQQSQLSSSSKRKIKKRRTARDKTYKPTVEDEADEADVLEEDAFVVPQIIAEGIARVEEVLEEFEEPEEKKKGKRKVKAKGIEKTVTFEVKKQPIAELETTTPESKACHKDEDNEKSYAKAAFAEDYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.17
5 0.16
6 0.16
7 0.14
8 0.13
9 0.13
10 0.12
11 0.1
12 0.1
13 0.11
14 0.1
15 0.08
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.04
22 0.05
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.13
30 0.14
31 0.16
32 0.22
33 0.3
34 0.35
35 0.43
36 0.52
37 0.59
38 0.68
39 0.75
40 0.8
41 0.83
42 0.89
43 0.92
44 0.93
45 0.93
46 0.9
47 0.86
48 0.85
49 0.77
50 0.68
51 0.61
52 0.53
53 0.44
54 0.36
55 0.3
56 0.22
57 0.18
58 0.15
59 0.12
60 0.08
61 0.06
62 0.06
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.02
69 0.03
70 0.02
71 0.02
72 0.03
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.07
90 0.07
91 0.1
92 0.14
93 0.15
94 0.21
95 0.3
96 0.4
97 0.48
98 0.57
99 0.64
100 0.7
101 0.8
102 0.83
103 0.84
104 0.82
105 0.8
106 0.76
107 0.67
108 0.6
109 0.53
110 0.49
111 0.4
112 0.36
113 0.37
114 0.36
115 0.38
116 0.35
117 0.34
118 0.31
119 0.35
120 0.33
121 0.28
122 0.24
123 0.26
124 0.28
125 0.26
126 0.24
127 0.19
128 0.2
129 0.24
130 0.29
131 0.29
132 0.34
133 0.35
134 0.44
135 0.54
136 0.61
137 0.57
138 0.54
139 0.52
140 0.46
141 0.46
142 0.38
143 0.29
144 0.22
145 0.2